Citrus Sinensis ID: 040310

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MEYYLNENFGFVKQKKSEEALERWRILSGFVKNRKRRFRFTANLAKRSEAEAIRRANLAVNLFFRRERLIEPEILNNQHSDGLIKAKMLTNQHEPKNPIGQDQLSLTKKVNKPKASDKRKRKVMNQETTHRITWFGTK
cccHHHHccccccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHcccccccccHHHHHHHHcccccEEEEEcccc
**YYLNENFGFVKQ***EEALERWRILSGFVKNRKRRFRFTANLAKRSEAEAIRRANLAVNLFFRRERLIEPEILNN****************EPKNPIGQDQLSLTKKV**************NQETTHRITWFGT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEYYLNENFGFVKQKKSEEALERWRILSGFVKNRKRRFRFTANLAKRSEAEAIRRANLAVNLFFRRERLIEPEILNNQHSDGLIKAKMLTNQHEPKNPIGQDQLSLTKKVNKPKASDKRKRKVMNQETTHRITWFGTK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcium-transporting ATPase 1, chloroplastic This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles.probableQ37145
Calcium-transporting ATPase 1, plasma membrane-type This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell, into the endoplasmic reticulum, or into organelles.probableQ2QMX9

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AQR, chain D
Confidence level:confident
Coverage over the Query: 16-67
View the alignment between query and template
View the model in PyMOL