Citrus Sinensis ID: 040325

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MYLLRSDVKSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDDETTNPVFNPKSRRKNITALVMGLCLGGGFLVGGVVLIIWLAGIGRKRKDGDEEDNQGFSEYIDD
ccEEEEEcccccEEEEEEEEEccccEEEEEEEccccccccccEEEEEEcccccccccEEEEEEccccccEEEEEEEEEEEEccccccccccccccccccccccEEEEEEEHHHHHHHHHHHHHHHHHHHEEEEEEccccccccccccccccc
cEEEEEEcccccEEEEEEEEcccccEEEEEEEccccccccccEEEEEccHHHHcccEEEEEEEEEccccccEEEEEEEEEEEEEcccccccccccccccccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHcccc
myllrsdvksgrrnEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLpefvtfgfsmatgvDFAIFSIYSWefnsslemddettnpvfnpksrrKNITALVMGLCLGGGFLVGGVVLIIWLAGigrkrkdgdeednqgfseyidd
myllrsdvksgrrnEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDDETTNPVFNPKSRRKNITALVMGLCLGGGFLVGGVVLIIWLAGigrkrkdgdeednqgfseyidd
MYLLRSDVKSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDDETTNPVFNPKSRRKNITAlvmglclgggflvggvvliiwlagigRKRKDGDEEDNQGFSEYIDD
***************AWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSL*****************KNITALVMGLCLGGGFLVGGVVLIIWLAGIG********************
MYLLRSDVKSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFNS************************LVMGLCLGGGFLVGGVVLIIWLAGIGRKRKDGDEEDNQGFSEYID*
MYLLRSDVKSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDDETTNPVFNPKSRRKNITALVMGLCLGGGFLVGGVVLIIWLAGIGRK**********GFSEYIDD
MYLLRSDVKSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDDETTNPVFN**SRRKNITALVMGLCLGGGFLVGGVVLIIWLAGIGRKRK****************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLLRSDVKSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDDETTNPVFNPKSRRKNITALVMGLCLGGGFLVGGVVLIIWLAGIGRKRKDGDEEDNQGFSEYIDD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query152 2.2.26 [Sep-21-2011]
Q93WH6275 Lectin OS=Lens culinaris N/A no 0.513 0.283 0.333 2e-06
P02870275 Lectin OS=Lens culinaris N/A no 0.513 0.283 0.333 2e-06
Q8VXF2275 Lectin OS=Lens culinaris N/A no 0.513 0.283 0.333 3e-06
Q93X49275 Lectin OS=Lens culinaris N/A no 0.513 0.283 0.333 3e-06
Q39529290 Agglutinin-2 OS=Cladrasti N/A no 0.506 0.265 0.415 3e-06
Q9LXA5 651 L-type lectin-domain cont yes no 0.828 0.193 0.291 3e-06
O04533 656 Putative L-type lectin-do no no 0.796 0.184 0.25 1e-05
Q39528293 Agglutinin-1 OS=Cladrasti N/A no 0.480 0.249 0.381 3e-05
P81637237 Lectin alpha chain OS=Dio N/A no 0.526 0.337 0.361 5e-05
P58907237 Lectin alpha chain OS=Dio N/A no 0.513 0.329 0.364 5e-05
>sp|Q93WH6|LEC_LENCC Lectin OS=Lens culinaris subsp. culinaris PE=3 SV=2 Back     alignment and function desciption
 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 47/81 (58%), Gaps = 3/81 (3%)

Query: 7   DVKSGRRNEAWISYNSSTHNLSVAFS---GLRNNSVVMQGLDYQVDLRQHLPEFVTFGFS 63
           ++++G R    I++N++T+ L+V  +    L   +V    L+  V L+  +PE+V  GFS
Sbjct: 183 NLQNGERANVVIAFNAATNVLTVTLTYPNSLEEENVTSYTLNEVVPLKDVVPEWVRIGFS 242

Query: 64  MATGVDFAIFSIYSWEFNSSL 84
             TG +FA   ++SW F+S L
Sbjct: 243 ATTGAEFAAHEVHSWSFHSEL 263
D-mannose specific lectin.
Lens culinaris subsp. culinaris (taxid: 362247)
>sp|P02870|LEC_LENCU Lectin OS=Lens culinaris PE=1 SV=2 Back     alignment and function description
>sp|Q8VXF2|LEC_LENCT Lectin OS=Lens culinaris subsp. tomentosus PE=3 SV=2 Back     alignment and function description
>sp|Q93X49|LEC_LENCO Lectin OS=Lens culinaris subsp. orientalis PE=3 SV=2 Back     alignment and function description
>sp|Q39529|LEC2_CLAKE Agglutinin-2 OS=Cladrastis kentukea PE=1 SV=1 Back     alignment and function description
>sp|Q9LXA5|LRK91_ARATH L-type lectin-domain containing receptor kinase IX.1 OS=Arabidopsis thaliana GN=LECRK91 PE=2 SV=1 Back     alignment and function description
>sp|O04533|LRK52_ARATH Putative L-type lectin-domain containing receptor kinase V.2 OS=Arabidopsis thaliana GN=LECRK52 PE=3 SV=1 Back     alignment and function description
>sp|Q39528|LEC1_CLAKE Agglutinin-1 OS=Cladrastis kentukea PE=1 SV=1 Back     alignment and function description
>sp|P81637|LECA_DIOGU Lectin alpha chain OS=Dioclea guianensis PE=1 SV=1 Back     alignment and function description
>sp|P58907|LECA_DIOVI Lectin alpha chain OS=Dioclea virgata PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query152
356527993 709 PREDICTED: L-type lectin-domain containi 0.953 0.204 0.443 8e-28
225470605 720 PREDICTED: L-type lectin-domain containi 0.848 0.179 0.507 4e-27
356527997 709 PREDICTED: L-type lectin-domain containi 0.921 0.197 0.433 3e-26
224096774 713 predicted protein [Populus trichocarpa] 0.953 0.203 0.478 3e-24
224092745 681 predicted protein [Populus trichocarpa] 0.848 0.189 0.483 5e-24
296088135 546 unnamed protein product [Vitis vinifera] 0.796 0.221 0.5 7e-24
449438590 665 PREDICTED: LOW QUALITY PROTEIN: L-type l 0.815 0.186 0.414 2e-23
449479044 678 PREDICTED: L-type lectin-domain containi 0.815 0.182 0.414 2e-23
357476157 782 Class I heat shock protein [Medicago tru 0.934 0.181 0.477 2e-23
356528003 671 PREDICTED: L-type lectin-domain containi 0.855 0.193 0.413 1e-22
>gi|356527993|ref|XP_003532590.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] Back     alignment and taxonomy information
 Score =  128 bits (321), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 97/158 (61%), Gaps = 13/158 (8%)

Query: 6   SDVKSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMA 65
           +D+K G+ NE WISYNSS+ NLSV F+G  N++++ Q L    DLR HLPEFVT GFS A
Sbjct: 191 ADIKQGKLNEVWISYNSSSFNLSVVFTGFNNDTILRQHLSAITDLRLHLPEFVTVGFSAA 250

Query: 66  TGVDFAIFSIYSWEFNSSLEMDDETTN--------PV---FNPKSRRKNITALVMGLCLG 114
           TG+D AI S+ SW+F+S+L   +  T         P      P  ++KN T L +GL +G
Sbjct: 251 TGIDTAIHSVNSWDFSSTLAAQENITKGADTVARYPATSNIAPSQKKKNKTGLAVGLSIG 310

Query: 115 GGFLVGGVVLIIWLAGIGRKRKDGDEEDNQGFSEYIDD 152
           G  L+GG+ LI    G+ +K K G  E++  F EY+ +
Sbjct: 311 GFVLIGGLGLIS--IGLWKKWKKGSVEEDLVFEEYMGE 346

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225470605|ref|XP_002262748.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356527997|ref|XP_003532592.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] Back     alignment and taxonomy information
>gi|224096774|ref|XP_002334671.1| predicted protein [Populus trichocarpa] gi|222874064|gb|EEF11195.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224092745|ref|XP_002334872.1| predicted protein [Populus trichocarpa] gi|222831889|gb|EEE70366.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296088135|emb|CBI35556.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449438590|ref|XP_004137071.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing receptor kinase IX.1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449479044|ref|XP_004155489.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357476157|ref|XP_003608364.1| Class I heat shock protein [Medicago truncatula] gi|355509419|gb|AES90561.1| Class I heat shock protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356528003|ref|XP_003532595.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query152
UNIPROTKB|P02870275 P02870 "Lectin" [Lens culinari 0.513 0.283 0.333 1e-07
UNIPROTKB|P83721234 P83721 "Mannose/glucose-specif 0.611 0.397 0.357 6.6e-07
UNIPROTKB|P58907237 P58907 "Lectin alpha chain" [D 0.513 0.329 0.370 1.5e-06
UNIPROTKB|P81637237 P81637 "Lectin alpha chain" [D 0.513 0.329 0.370 1.5e-06
UNIPROTKB|P81517236 P81517 "Lectin alpha chain" [C 0.513 0.330 0.382 1.9e-06
UNIPROTKB|B3EWJ2237 B3EWJ2 "Lectin alpha chain" [D 0.5 0.320 0.373 2.5e-06
UNIPROTKB|P08902237 P08902 "Lectin alpha chain" [D 0.5 0.320 0.373 2.5e-06
TAIR|locus:2143528 711 AT5G03140 [Arabidopsis thalian 0.631 0.135 0.326 3.8e-06
UNIPROTKB|Q70DJ5280 Q70DJ5 "Alpha-methyl-mannoside 0.480 0.260 0.342 3.8e-06
UNIPROTKB|P58908237 P58908 "Lectin alpha chain" [D 0.513 0.329 0.358 4.2e-06
UNIPROTKB|P02870 P02870 "Lectin" [Lens culinaris (taxid:3864)] Back     alignment and assigned GO terms
 Score = 126 (49.4 bits), Expect = 1.0e-07, P = 1.0e-07
 Identities = 27/81 (33%), Positives = 47/81 (58%)

Query:     7 DVKSGRRNEAWISYNSSTHNLSVAFS---GLRNNSVVMQGLDYQVDLRQHLPEFVTFGFS 63
             ++++G R    I++N++T+ L+V  +    L   +V    L+  V L+  +PE+V  GFS
Sbjct:   183 NLQNGERANVVIAFNAATNVLTVTLTYPNSLEEENVTSYTLNEVVPLKDVVPEWVRIGFS 242

Query:    64 MATGVDFAIFSIYSWEFNSSL 84
               TG +FA   ++SW F+S L
Sbjct:   243 ATTGAEFAAHEVHSWSFHSEL 263
GO:0005509 "calcium ion binding" evidence=IDA
GO:0009756 "carbohydrate mediated signaling" evidence=TAS
GO:0030145 "manganese ion binding" evidence=IDA
GO:0030246 "carbohydrate binding" evidence=IDA
UNIPROTKB|P83721 P83721 "Mannose/glucose-specific lectin Cramoll" [Cratylia mollis (taxid:252530)] Back     alignment and assigned GO terms
UNIPROTKB|P58907 P58907 "Lectin alpha chain" [Dioclea virgata (taxid:167618)] Back     alignment and assigned GO terms
UNIPROTKB|P81637 P81637 "Lectin alpha chain" [Dioclea guianensis (taxid:99571)] Back     alignment and assigned GO terms
UNIPROTKB|P81517 P81517 "Lectin alpha chain" [Cratylia argentea (taxid:83131)] Back     alignment and assigned GO terms
UNIPROTKB|B3EWJ2 B3EWJ2 "Lectin alpha chain" [Dioclea sclerocarpa (taxid:1176036)] Back     alignment and assigned GO terms
UNIPROTKB|P08902 P08902 "Lectin alpha chain" [Dioclea grandiflora (taxid:3837)] Back     alignment and assigned GO terms
TAIR|locus:2143528 AT5G03140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q70DJ5 Q70DJ5 "Alpha-methyl-mannoside-specific lectin" [Arachis hypogaea (taxid:3818)] Back     alignment and assigned GO terms
UNIPROTKB|P58908 P58908 "Lectin alpha chain" [Dioclea rostrata (taxid:192416)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
cd06899236 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume 2e-19
pfam00139231 pfam00139, Lectin_legB, Legume lectin domain 6e-11
cd01951223 cd01951, lectin_L-type, legume lectins 5e-07
>gnl|CDD|173887 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information 
 Score = 80.7 bits (200), Expect = 2e-19
 Identities = 31/76 (40%), Positives = 42/76 (55%)

Query: 9   KSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGV 68
           KSG+  +AWI Y+SS+  LSV  +           L Y VDL + LPE V  GFS +TG+
Sbjct: 161 KSGKPMQAWIDYDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGL 220

Query: 69  DFAIFSIYSWEFNSSL 84
              +  I SW F+S+ 
Sbjct: 221 LTELHYILSWSFSSNG 236

This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by binding glycans on the cell surface. Medically, PHA is used as a mitogen to trigger cell division in T-lymphocytes and to activate latent HIV-1 from human peripheral lymphocytes. Plant L-type lectins are primarily found in the seeds of leguminous plants where they constitute about 10% of the total soluble protein of the seed extracts. They are synthesized during seed development several weeks after flowering and transported to the vacuole where they become condensed into specialized vesicles called protein bodies. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely. Length = 236
>gnl|CDD|215744 pfam00139, Lectin_legB, Legume lectin domain Back     alignment and domain information
>gnl|CDD|173886 cd01951, lectin_L-type, legume lectins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 152
cd06899236 lectin_legume_LecRK_Arcelin_ConA legume lectins, l 99.87
PF00139236 Lectin_legB: Legume lectin domain; InterPro: IPR00 99.84
cd01951223 lectin_L-type legume lectins. The L-type (legume-t 99.7
cd07308218 lectin_leg-like legume-like lectins: ERGIC-53, ERG 98.33
cd06902225 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran 98.0
PF03388229 Lectin_leg-like: Legume-like lectin family; InterP 96.72
cd06903215 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem 96.62
PF15065350 NCU-G1: Lysosomal transcription factor, NCU-G1 96.43
KOG3839351 consensus Lectin VIP36, involved in the transport 96.23
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 96.2
cd06901248 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr 96.15
KOG3838 497 consensus Mannose lectin ERGIC-53, involved in gly 95.89
PF06697278 DUF1191: Protein of unknown function (DUF1191); In 95.2
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 93.96
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 92.74
PF15102146 TMEM154: TMEM154 protein family 92.73
PHA03265402 envelope glycoprotein D; Provisional 88.19
PF01299306 Lamp: Lysosome-associated membrane glycoprotein (L 86.67
PF14610189 DUF4448: Protein of unknown function (DUF4448) 86.3
cd06900255 lectin_VcfQ VcfQ bacterial pilus biogenesis protei 85.39
PF05454290 DAG1: Dystroglycan (Dystrophin-associated glycopro 85.26
PF06365202 CD34_antigen: CD34/Podocalyxin family; InterPro: I 85.14
PF0554549 FixQ: Cbb3-type cytochrome oxidase component FixQ; 82.2
PF03302397 VSP: Giardia variant-specific surface protein; Int 80.54
>cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information 
Probab=99.87  E-value=4.2e-22  Score=160.38  Aligned_cols=77  Identities=40%  Similarity=0.596  Sum_probs=72.6

Q ss_pred             ccCCCceEEEEEEeeCCCCeEEEEEEcCCCCCcccceeEEeecCCCCCCCceEEEEEeecCCcceeEEEEeeeeeeC
Q 040325            7 DVKSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFNSS   83 (152)
Q Consensus         7 ~l~sG~~~~awI~Yd~~~~~L~V~l~~~~~~~p~~p~Ls~~vdLs~~L~e~v~VGFSasTG~~~~~h~ilsWsF~~~   83 (152)
                      .+.+|+.++|||+||+.+++|+|+|.+....+|..|+|+..+||+.+|+++||||||||||...|.|+|++|+|+++
T Consensus       159 ~l~~g~~~~v~I~Y~~~~~~L~V~l~~~~~~~~~~~~ls~~vdL~~~l~~~~~vGFSasTG~~~~~h~i~sWsF~s~  235 (236)
T cd06899         159 KLKSGKPMQAWIDYDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWSFSSN  235 (236)
T ss_pred             cccCCCeEEEEEEEcCCCCEEEEEEEeCCCCCCcCCEEEEeccHHHhCCCceEEEEEeEcCCCcceEEEEEEEEEcC
Confidence            36899999999999999999999999776568999999999999999999999999999999999999999999976

This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin
>PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported Back     alignment and domain information
>cd01951 lectin_L-type legume lectins Back     alignment and domain information
>cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 Back     alignment and domain information
>cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates Back     alignment and domain information
>cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>PF15065 NCU-G1: Lysosomal transcription factor, NCU-G1 Back     alignment and domain information
>KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain Back     alignment and domain information
>KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06697 DUF1191: Protein of unknown function (DUF1191); InterPro: IPR010605 This family contains hypothetical plant proteins of unknown function Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>PF15102 TMEM154: TMEM154 protein family Back     alignment and domain information
>PHA03265 envelope glycoprotein D; Provisional Back     alignment and domain information
>PF01299 Lamp: Lysosome-associated membrane glycoprotein (Lamp); InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear Back     alignment and domain information
>PF14610 DUF4448: Protein of unknown function (DUF4448) Back     alignment and domain information
>cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain Back     alignment and domain information
>PF05454 DAG1: Dystroglycan (Dystrophin-associated glycoprotein 1); InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5 Back     alignment and domain information
>PF06365 CD34_antigen: CD34/Podocalyxin family; InterPro: IPR013836 This family consists of several mammalian CD34 antigen proteins Back     alignment and domain information
>PF05545 FixQ: Cbb3-type cytochrome oxidase component FixQ; InterPro: IPR008621 This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ) Back     alignment and domain information
>PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
1mvq_A236 Cratylia Mollis Lectin (Isoform 1) In Complex With 6e-07
2jdz_A239 Crystal Structure Of Recombinant Dioclea Guianensis 1e-06
2je7_A239 Crystal Structure Of Recombinant Dioclea Guianensis 1e-06
3u4x_A236 Crystal Structure Of A Lectin From Camptosema Pedic 1e-06
1gnz_A257 Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)m 2e-06
1hql_A257 The Xenograft Antigen In Complex With The B4 Isolec 2e-06
1h9w_A237 Native Dioclea Guianensis Seed Lectin Length = 237 3e-06
1h9p_A237 Crystal Structure Of Dioclea Guianensis Seed Lectin 3e-06
3a0k_A237 Crystal Structure Of An Antiflamatory Legume Lectin 3e-06
3rrd_A237 Native Structure Of Dioclea Virgata Lectin Length = 3e-06
1n3o_A252 Pterocarcpus Angolensis Lectin In Complex With Alph 4e-06
1q8o_A252 Pterocartpus Angolensis Lectin Pal In Complex With 4e-06
2d3p_A236 Cratylia Floribunda Seed Lectin Crystallized At Bas 4e-06
1qmo_E133 Structure Of Fril, A Legume Lectin That Delays Hema 4e-06
3sh3_A237 Crystal Structure Of A Pro-Inflammatory Lectin From 5e-06
2jec_A239 Crystal Structure Of Recombinant Dioclea Grandiflor 5e-06
2je9_A239 Crystal Structure Of Recombinant Dioclea Grandiflor 5e-06
1dgl_A237 Lectin From Dioclea Grandiflora Complexed To Triman 5e-06
2gdf_A237 Crystal Structure Of Dioclea Violacea Seed Lectin L 6e-06
2zbj_A237 Crystal Structure Of Dioclea Rostrata Lectin Length 8e-06
2bqp_A234 The Structure Of The Pea Lectin-D-Glucopyranose Com 1e-05
1lul_A253 Db58, A Legume Lectin From Dolichos Biflorus Length 2e-05
1bjq_A253 The Dolichos Biflorus Seed Lectin In Complex With A 3e-05
3zvx_A261 Structure Of The Lectin From Platypodium Elegans In 6e-05
2sba_A253 Soybean Agglutinin Complexed With 2,6-Pentasacchari 6e-05
1fat_A252 Phytohemagglutinin-L Length = 252 7e-05
2ovu_A237 Crystal Strucure Of A Lectin From Canavalia Gladiat 8e-05
1wuv_A237 Crystal Structure Of Native Canavalia Gladiata Lect 8e-05
2cwm_A237 Native Crystal Structure Of No Releasing Inductive 8e-05
1azd_A237 Concanavalin From Canavalia Brasiliensis Length = 2 9e-05
2ow4_A237 Crystal Structure Of A Lectin From Canavalia Mariti 9e-05
1lgc_B53 Interaction Of A Legume Lectin With The N2 Fragment 9e-05
1lgb_B53 Interaction Of A Legume Lectin With The N2 Fragment 9e-05
1fny_A237 Legume Lectin Of The Bark Of Robinia Pseudoacacia. 1e-04
2ctv_A237 High Resolution Crystallographic Studies Of Native 1e-04
2fmd_A240 Structural Basis Of Carbohydrate Recognition By Bow 1e-04
2lal_B52 Crystal Structure Determination And Refinement At 2 1e-04
2yz4_A237 The Neutron Structure Of Concanavalin A At 2.2 Angs 1e-04
1qnw_A242 Lectin Ii From Ulex Europaeus Length = 242 2e-04
3ujo_A281 Galactose-Specific Seed Lectin From Dolichos Lablab 2e-04
1les_B52 Lentil Lectin Complexed With Sucrose Length = 52 3e-04
1cn1_A237 Crystal Structure Of Demetallized Concanavalin A. T 3e-04
2cna_A237 The Covalent And Three-Dimensional Structure Of Con 3e-04
3usu_B242 Crystal Structure Of Butea Monosperma Seed Lectin L 4e-04
1lof_D52 X-Ray Structure Of A Biantennary Octasaccharide-Lec 4e-04
1n47_A233 Isolectin B4 From Vicia Villosa In Complex With The 4e-04
3usu_A256 Crystal Structure Of Butea Monosperma Seed Lectin L 4e-04
1loa_B52 Three-Dimensional Structures Of Complexes Of Lathyr 4e-04
2pel_A236 Peanut Lectin Length = 236 6e-04
1g8w_A233 Improved Structure Of Phytohemagglutinin-L From The 6e-04
1bzw_A232 Peanut Lectin Complexed With C-Lactose Length = 232 6e-04
>pdb|1MVQ|A Chain A, Cratylia Mollis Lectin (Isoform 1) In Complex With Methyl-Alpha-D- Mannose Length = 236 Back     alignment and structure 
Iteration: 1

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 42/81 (51%), Gaps = 3/81 (3%)
Query: 5   RSDVKSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSM 64
           R DV++G+   A ISYNS    LS   S    +S  +    Y VDL   LPE+V  G S 
Sbjct: 39  RWDVQNGKVGTAHISYNSVAKRLSAVVSYPGGSSATVS---YDVDLNNILPEWVRVGLSA 95
Query: 65  ATGVDFAIFSIYSWEFNSSLE 85
           +TG+     +I SW F S L+
Sbjct: 96  STGLYKETNTILSWSFTSKLK 116
>pdb|2JDZ|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2JE7|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin S131h Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|3U4X|A Chain A, Crystal Structure Of A Lectin From Camptosema Pedicellatum Seeds In Complex With 5-Bromo-4-Chloro-3-Indolyl-Alpha-D-Mannose Length = 236 Back     alignment and structure
>pdb|1GNZ|A Chain A, Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)metal Free Form Length = 257 Back     alignment and structure
>pdb|1HQL|A Chain A, The Xenograft Antigen In Complex With The B4 Isolectin Of Griffonia Simplicifolia Lectin-1 Length = 257 Back     alignment and structure
>pdb|1H9W|A Chain A, Native Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|1H9P|A Chain A, Crystal Structure Of Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|3A0K|A Chain A, Crystal Structure Of An Antiflamatory Legume Lectin From Cymbosema Roseum Seeds Length = 237 Back     alignment and structure
>pdb|3RRD|A Chain A, Native Structure Of Dioclea Virgata Lectin Length = 237 Back     alignment and structure
>pdb|1N3O|A Chain A, Pterocarcpus Angolensis Lectin In Complex With Alpha-Methyl Glucose Length = 252 Back     alignment and structure
>pdb|1Q8O|A Chain A, Pterocartpus Angolensis Lectin Pal In Complex With The Dimmanoside Man(Alpha1-2)man Length = 252 Back     alignment and structure
>pdb|2D3P|A Chain A, Cratylia Floribunda Seed Lectin Crystallized At Basic Ph Length = 236 Back     alignment and structure
>pdb|1QMO|E Chain E, Structure Of Fril, A Legume Lectin That Delays Hematopoietic Progenitor Maturation Length = 133 Back     alignment and structure
>pdb|3SH3|A Chain A, Crystal Structure Of A Pro-Inflammatory Lectin From The Seeds Of Dioclea Wilsonii Standl Length = 237 Back     alignment and structure
>pdb|2JEC|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Mutant E123a-H131n-K132q Complexed With 5-Bromo-4-Chloro-3- Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2JE9|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|1DGL|A Chain A, Lectin From Dioclea Grandiflora Complexed To Trimannoside Length = 237 Back     alignment and structure
>pdb|2GDF|A Chain A, Crystal Structure Of Dioclea Violacea Seed Lectin Length = 237 Back     alignment and structure
>pdb|2ZBJ|A Chain A, Crystal Structure Of Dioclea Rostrata Lectin Length = 237 Back     alignment and structure
>pdb|2BQP|A Chain A, The Structure Of The Pea Lectin-D-Glucopyranose Complex Length = 234 Back     alignment and structure
>pdb|1LUL|A Chain A, Db58, A Legume Lectin From Dolichos Biflorus Length = 253 Back     alignment and structure
>pdb|1BJQ|A Chain A, The Dolichos Biflorus Seed Lectin In Complex With Adenine Length = 253 Back     alignment and structure
>pdb|3ZVX|A Chain A, Structure Of The Lectin From Platypodium Elegans In Complex With A Trimannoside Length = 261 Back     alignment and structure
>pdb|2SBA|A Chain A, Soybean Agglutinin Complexed With 2,6-Pentasaccharide Length = 253 Back     alignment and structure
>pdb|1FAT|A Chain A, Phytohemagglutinin-L Length = 252 Back     alignment and structure
>pdb|2OVU|A Chain A, Crystal Strucure Of A Lectin From Canavalia Gladiata (Cgl) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|1WUV|A Chain A, Crystal Structure Of Native Canavalia Gladiata Lectin (Cgl): A Tetrameric Cona-Like Lectin Length = 237 Back     alignment and structure
>pdb|2CWM|A Chain A, Native Crystal Structure Of No Releasing Inductive Lectin From Seeds Of The Canavalia Maritima (Conm) Length = 237 Back     alignment and structure
>pdb|1AZD|A Chain A, Concanavalin From Canavalia Brasiliensis Length = 237 Back     alignment and structure
>pdb|2OW4|A Chain A, Crystal Structure Of A Lectin From Canavalia Maritima Seeds (Conm) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|1LGC|B Chain B, Interaction Of A Legume Lectin With The N2 Fragment Of Human Lactotransferrin Or With The Isolated Biantennary Glycopeptide: Role Of The Fucose Moiety Length = 53 Back     alignment and structure
>pdb|1LGB|B Chain B, Interaction Of A Legume Lectin With The N2 Fragment Of Human Lactotransferrin Or With The Isolated Biantennary Glycopeptide: Role Of The Fucose Moiety Length = 53 Back     alignment and structure
>pdb|1FNY|A Chain A, Legume Lectin Of The Bark Of Robinia Pseudoacacia. Length = 237 Back     alignment and structure
>pdb|2CTV|A Chain A, High Resolution Crystallographic Studies Of Native Concanavalin A Using Rapid Laue Data Collection Methods And The Introduction Of A Monochromatic Large-Angle Oscillation Technique (Lot) Length = 237 Back     alignment and structure
>pdb|2FMD|A Chain A, Structural Basis Of Carbohydrate Recognition By Bowringia Milbraedii Seed Agglutinin Length = 240 Back     alignment and structure
>pdb|2LAL|B Chain B, Crystal Structure Determination And Refinement At 2.3 Angstroms Resolution Of The Lentil Lectin Length = 52 Back     alignment and structure
>pdb|2YZ4|A Chain A, The Neutron Structure Of Concanavalin A At 2.2 Angstroms Length = 237 Back     alignment and structure
>pdb|1QNW|A Chain A, Lectin Ii From Ulex Europaeus Length = 242 Back     alignment and structure
>pdb|3UJO|A Chain A, Galactose-Specific Seed Lectin From Dolichos Lablab In Complex With Adenine And Galactose Length = 281 Back     alignment and structure
>pdb|1LES|B Chain B, Lentil Lectin Complexed With Sucrose Length = 52 Back     alignment and structure
>pdb|1CN1|A Chain A, Crystal Structure Of Demetallized Concanavalin A. The Metal- Binding Region Length = 237 Back     alignment and structure
>pdb|2CNA|A Chain A, The Covalent And Three-Dimensional Structure Of Concanavalin A, Iv.Atomic Coordinates,Hydrogen Bonding,And Quaternary Structure Length = 237 Back     alignment and structure
>pdb|3USU|B Chain B, Crystal Structure Of Butea Monosperma Seed Lectin Length = 242 Back     alignment and structure
>pdb|1LOF|D Chain D, X-Ray Structure Of A Biantennary Octasaccharide-Lectin Complex At 2.3 Angstroms Resolution Length = 52 Back     alignment and structure
>pdb|1N47|A Chain A, Isolectin B4 From Vicia Villosa In Complex With The Tn Antigen Length = 233 Back     alignment and structure
>pdb|3USU|A Chain A, Crystal Structure Of Butea Monosperma Seed Lectin Length = 256 Back     alignment and structure
>pdb|1LOA|B Chain B, Three-Dimensional Structures Of Complexes Of Lathyrus Ochrus Isolectin I With Glucose And Mannose: Fine Specificity Of The Monosaccharide-Binding Site Length = 52 Back     alignment and structure
>pdb|2PEL|A Chain A, Peanut Lectin Length = 236 Back     alignment and structure
>pdb|1G8W|A Chain A, Improved Structure Of Phytohemagglutinin-L From The Kidney Bean Length = 233 Back     alignment and structure
>pdb|1BZW|A Chain A, Peanut Lectin Complexed With C-Lactose Length = 232 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 2e-15
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 1e-14
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 2e-14
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 2e-14
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 4e-14
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 2e-13
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 3e-13
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 3e-13
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 4e-13
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 5e-13
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 7e-13
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 7e-13
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 1e-12
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 1e-12
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 1e-12
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 2e-12
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 3e-12
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 3e-12
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 4e-12
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 4e-12
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 8e-12
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 2e-11
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 5e-11
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 5e-11
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 6e-11
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 133 Back     alignment and structure
 Score = 67.4 bits (164), Expect = 2e-15
 Identities = 32/101 (31%), Positives = 48/101 (47%), Gaps = 9/101 (8%)

Query: 9   KSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGV 68
           ++G+   A ISYNS +  LSV      +       L Y ++L   LPE+V  G S +TG 
Sbjct: 42  QNGKIATAHISYNSVSKRLSVTSYYAGSKPAT---LSYDIELHTVLPEWVRVGLSASTGQ 98

Query: 69  DFAIFSIYSWEFNSSLEMDDETTNPVFNPKSRRKNITALVM 109
           D    +++SW F SSL  +          ++  K IT  V+
Sbjct: 99  DKERNTVHSWSFTSSLWTNVA------KKENENKYITRGVL 133
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Length = 240 Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 226 Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Length = 261 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Length = 223 Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Length = 232 Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Length = 239 Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Length = 242 Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Length = 252 Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Length = 233 Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Length = 253 Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Length = 52 Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Length = 242 Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Length = 251 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Length = 237 Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Length = 234 Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 240 Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Length = 257 Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Length = 243 Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Length = 234 Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Length = 239 Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Length = 242 Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Length = 238 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Length = 253 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query152
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 99.94
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 99.92
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 99.91
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 99.91
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 99.91
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 99.91
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 99.91
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 99.91
3ujo_A281 Legume lectin; carbohydrate-binding, galactose, ad 99.91
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 99.91
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 99.9
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 99.9
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 99.9
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 99.9
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 99.9
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 99.9
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 99.9
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 99.89
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 99.89
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 99.89
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 99.89
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 99.89
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 99.88
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 99.88
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 99.88
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 99.78
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 99.62
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 99.61
2a6y_A256 EMP47P (FORM1); beta sandwich, carbohydrate bindin 99.12
2a6z_A222 EMP47P (FORM2); beta sandwich, carbohydrate bindin 98.17
2a6v_A226 EMP46P; beta sandwich, carbohydrate binding protei 96.83
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 92.89
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 92.38
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 88.93
2k1k_A38 Ephrin type-A receptor 1; EPHA1, receptor tyrosine 81.74
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Back     alignment and structure
Probab=99.94  E-value=7.7e-27  Score=172.89  Aligned_cols=77  Identities=38%  Similarity=0.516  Sum_probs=71.0

Q ss_pred             ccCCCceEEEEEEeeCCCCeEEEEEEcCCCCCcccceeEEeecCCCCCCCceEEEEEeecCCcceeEEEEeeeeeeCCCC
Q 040325            7 DVKSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEM   86 (152)
Q Consensus         7 ~l~sG~~~~awI~Yd~~~~~L~V~l~~~~~~~p~~p~Ls~~vdLs~~L~e~v~VGFSasTG~~~~~h~ilsWsF~~~~~~   86 (152)
                      ++.+|+.++|||+||+.+++|+|+|++.+. +  +|+|++.+||+++|||+||||||||||...|.|+|++|+|+++++.
T Consensus        40 ~l~sG~~~~v~I~Yd~~~~~L~V~l~~~~~-~--~p~ls~~vdLs~~l~e~v~VGFSAsTG~~~~~h~IlsWsF~s~l~~  116 (133)
T 1qmo_E           40 DWQNGKIATAHISYNSVSKRLSVTSYYAGS-K--PATLSYDIELHTVLPEWVRVGLSASTGQDKERNTVHSWSFTSSLWT  116 (133)
T ss_dssp             CCCTTSCEEEEEEEETTTTEEEEEEECSSS-C--CEEEEEECCGGGTSCSEEEEEEEEECSSSCCEEEEEEEEEEEEEEE
T ss_pred             EEcCCCEEEEEEEEeCCCcEEEEEEccCCC-c--cceEEEeechHHhccccEEEEEEeccCCCcceeEEEEEEEEeeCCC
Confidence            478999999999999999999999997653 2  7899999999999999999999999999999999999999998643
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Back     alignment and structure
>3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Back     alignment and structure
>2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Back     alignment and structure
>2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A Back     alignment and structure
>2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 152
g1qmo.1230 b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich 8e-16
d1qnwa_237 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 2e-15
d1gzca_239 b.29.1.1 (A:) Legume lectin {Cockspur coral tree ( 3e-15
d1nlsa_237 b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia 4e-15
d1v6ia_232 b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog 5e-15
d1g7ya_253 b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos 1e-14
d1hqla_236 b.29.1.1 (A:) Legume lectin {Griffonia simplicifol 1e-14
d1ukga_241 b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero 5e-14
d1leda_243 b.29.1.1 (A:) Legume lectin {West-central african 9e-14
d1f9ka_234 b.29.1.1 (A:) Legume lectin {Winged bean (Psophoca 1e-13
d1n47a_233 b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi 1e-13
d1avba_226 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 1e-13
g2ltn.1229 b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum 2e-13
d1g8wa_233 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 3e-13
d1fx5a_240 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 4e-13
d1ioaa_228 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 4e-13
d2d3sa1237 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Pso 5e-13
d1g9fa_251 b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) 9e-13
d1dhkb_204 b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar 1e-12
d1fnya_237 b.29.1.1 (A:) Legume lectin {Black locust (Robinia 2e-12
d1dbna_239 b.29.1.1 (A:) Legume lectin {Maackia amurensis, le 2e-11
d1gv9a_228 b.29.1.13 (A:) Carbohydrate-recognition domain of 3e-06
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Length = 237 Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Length = 239 Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 Back     information, alignment and structure
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Length = 236 Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Length = 243 Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Length = 240 Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Length = 237 Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query152
d1qnwa_237 Legume lectin {Furze (Ulex europaeus), UEA-II [Tax 99.89
d1hqla_236 Legume lectin {Griffonia simplicifolia, lectin I-b 99.88
d1gzca_239 Legume lectin {Cockspur coral tree (Erythrina cris 99.88
d1ioaa_228 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.88
d1g9fa_251 Legume lectin {Soybean (Glycine max) [TaxId: 3847] 99.87
d1nlsa_237 Concanavalin A {Jack bean (Canavalia ensiformis) [ 99.87
d1leda_243 Legume lectin {West-central african legume (Griffo 99.87
d2d3sa1237 Legume lectin {Winged bean (Psophocarpus tetragono 99.87
d1f9ka_234 Legume lectin {Winged bean (Psophocarpus tetragono 99.87
d1fx5a_240 Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI 99.87
d1dhkb_204 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.86
d1ukga_241 Legume lectin {Bloodwood tree (Pterocarpus angolen 99.86
d1g7ya_253 Legume lectin {Horse gram (Dolichos biflorus), dif 99.85
d1n47a_233 Legume lectin {Hairy vetch (Vicia villosa), isolec 99.85
g1qmo.1230 Legume lectin {Field bean (Dolichos lablab), Fril 99.84
d1v6ia_232 Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 99.84
d1fnya_237 Legume lectin {Black locust (Robinia pseudoacacia) 99.83
d1g8wa_233 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.83
d1avba_226 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.82
d1dbna_239 Legume lectin {Maackia amurensis, leukoagglutinin 99.81
g2ltn.1229 Legume lectin {Garden pea (Pisum sativum) [TaxId: 99.8
d1gv9a_228 Carbohydrate-recognition domain of P58/ERGIC-53 {R 99.07
d2a6va1218 Emp46p N-terminal domain {Baker's yeast (Saccharom 98.12
d2a6za1221 Emp47p N-terminal domain {Baker's yeast (Saccharom 97.62
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Legume lectin
species: Furze (Ulex europaeus), UEA-II [TaxId: 3902]

Probab=99.89  E-value=8e-24  Score=167.23  Aligned_cols=78  Identities=33%  Similarity=0.519  Sum_probs=71.1

Q ss_pred             cccCCCceEEEEEEeeCCCCeEEEEEEcCCCCCcccceeEEeecCCCCCCCceEEEEEeecCCc--ceeEEEEeeeeeeC
Q 040325            6 SDVKSGRRNEAWISYNSSTHNLSVAFSGLRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMATGVD--FAIFSIYSWEFNSS   83 (152)
Q Consensus         6 ~~l~sG~~~~awI~Yd~~~~~L~V~l~~~~~~~p~~p~Ls~~vdLs~~L~e~v~VGFSasTG~~--~~~h~ilsWsF~~~   83 (152)
                      .++.+|+.++|||+||+.+++|+|++.+..  +|..|+|++.+||+++|+|+||||||||||..  .|.|+|++|+|+++
T Consensus       158 ~~~~~G~~~~v~I~Yd~~~~~L~V~l~~~~--~~~~p~ls~~vDLs~~l~~~vyvGFSasTG~~~~~q~h~I~sWsF~s~  235 (237)
T d1qnwa_         158 WDWRNGEVADVVITYRAPTKSLTVCLSYPS--DGTSNIITASVDLKAILPEWVSVGFSGGVGNAAEFETHDVLSWYFTSN  235 (237)
T ss_dssp             CCCCTTCCEEEEEEEEGGGTEEEEEEECTT--TCCEEEEEEECCHHHHSCSEEEEEEEEEESCGGGCBCCEEEEEEEEEE
T ss_pred             cccCCCcEEEEEEEEcCCCcEEEEEEecCC--CCccceEEEEEChHHhCCCcEEEEEEeECCCCCCccEeEEEEeEeEEe
Confidence            458899999999999999999999999654  78899999999999999999999999999985  48999999999987


Q ss_pred             CC
Q 040325           84 LE   85 (152)
Q Consensus        84 ~~   85 (152)
                      ++
T Consensus       236 l~  237 (237)
T d1qnwa_         236 LE  237 (237)
T ss_dssp             C-
T ss_pred             cC
Confidence            63
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure