Citrus Sinensis ID: 040356
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 226 | ||||||
| 145332667 | 1480 | bifunctional inhibitor/lipid transfer pr | 0.473 | 0.072 | 0.601 | 6e-30 | |
| 15022163 | 407 | putative proline-rich protein [Solanum p | 0.380 | 0.211 | 0.715 | 9e-29 | |
| 297835204 | 722 | predicted protein [Arabidopsis lyrata su | 0.384 | 0.120 | 0.651 | 6e-28 | |
| 449456667 | 254 | PREDICTED: uncharacterized protein LOC10 | 0.384 | 0.342 | 0.685 | 1e-27 | |
| 449518449 | 143 | PREDICTED: 36.4 kDa proline-rich protein | 0.384 | 0.608 | 0.685 | 2e-27 | |
| 296087554 | 135 | unnamed protein product [Vitis vinifera] | 0.384 | 0.644 | 0.674 | 2e-27 | |
| 118486411 | 179 | unknown [Populus trichocarpa] | 0.384 | 0.486 | 0.696 | 3e-27 | |
| 224104875 | 179 | predicted protein [Populus trichocarpa] | 0.384 | 0.486 | 0.696 | 5e-27 | |
| 255559090 | 299 | Repetitive proline-rich cell wall protei | 0.384 | 0.290 | 0.696 | 2e-26 | |
| 224086363 | 85 | predicted protein [Populus trichocarpa] | 0.376 | 1.0 | 0.701 | 2e-26 |
| >gi|145332667|ref|NP_001078199.1| bifunctional inhibitor/lipid transfer protein/seed storage protein-like protein [Arabidopsis thaliana] gi|11994733|dbj|BAB03062.1| unnamed protein product [Arabidopsis thaliana] gi|332643072|gb|AEE76593.1| bifunctional inhibitor/lipid transfer protein/seed storage protein-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Score = 136 bits (343), Expect = 6e-30, Method: Compositional matrix adjust.
Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 6/113 (5%)
Query: 115 PPVVKSP-PTPPNVRYP---PPPKQQKTCPINALKLSACVDVLGGLIQIGLGDSAKEKCC 170
PPV SP TPP + P PP KTCPI+ LKL +CVD+LGGL+ IG+G SAKEKCC
Sbjct: 1369 PPVASSPIATPPIAKTPIATPPTTMPKTCPIDTLKLGSCVDLLGGLVHIGIGKSAKEKCC 1428
Query: 171 PLLHGLVDLDAAICLCTAIRIKAPNLINLLVPISLQVLVNDCGKYPPAGFQCP 223
P++ GLVDLDAA+CLCT I+ K N I++++PI+L+VL+N CGK PP GF+CP
Sbjct: 1429 PVVEGLVDLDAAVCLCTTIKAKLLN-IDVILPIALEVLLN-CGKNPPPGFKCP 1479
|
Source: Arabidopsis thaliana Species: Arabidopsis thaliana Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|15022163|gb|AAC49600.2| putative proline-rich protein [Solanum palustre] | Back alignment and taxonomy information |
|---|
| >gi|297835204|ref|XP_002885484.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297331324|gb|EFH61743.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449456667|ref|XP_004146070.1| PREDICTED: uncharacterized protein LOC101218239 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449518449|ref|XP_004166254.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|296087554|emb|CBI34143.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|118486411|gb|ABK95045.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224104875|ref|XP_002333889.1| predicted protein [Populus trichocarpa] gi|222838950|gb|EEE77301.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255559090|ref|XP_002520567.1| Repetitive proline-rich cell wall protein 2 precursor, putative [Ricinus communis] gi|223540227|gb|EEF41800.1| Repetitive proline-rich cell wall protein 2 precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224086363|ref|XP_002307865.1| predicted protein [Populus trichocarpa] gi|222853841|gb|EEE91388.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 226 | ||||||
| TAIR|locus:2203876 | 297 | AT1G62500 [Arabidopsis thalian | 0.393 | 0.299 | 0.615 | 8.2e-28 | |
| TAIR|locus:4010713767 | 1480 | AT3G22142 "AT3G22142" [Arabido | 0.376 | 0.057 | 0.655 | 3.6e-27 | |
| TAIR|locus:2090419 | 334 | CWLP "cell wall-plasma membran | 0.376 | 0.254 | 0.647 | 1.2e-26 | |
| TAIR|locus:2041927 | 291 | AT2G10940 [Arabidopsis thalian | 0.367 | 0.285 | 0.623 | 1.4e-25 | |
| TAIR|locus:2135595 | 161 | AZI1 "azelaic acid induced 1" | 0.371 | 0.521 | 0.564 | 1.9e-21 | |
| TAIR|locus:2135610 | 168 | EARLI1 "EARLY ARABIDOPSIS ALUM | 0.367 | 0.494 | 0.571 | 3.9e-21 | |
| TAIR|locus:2135635 | 177 | AT4G12500 [Arabidopsis thalian | 0.367 | 0.468 | 0.559 | 8e-21 | |
| TAIR|locus:2135625 | 182 | AT4G12490 [Arabidopsis thalian | 0.367 | 0.456 | 0.547 | 8e-21 | |
| TAIR|locus:2135545 | 129 | AT4G12510 [Arabidopsis thalian | 0.389 | 0.682 | 0.516 | 3.1e-19 | |
| TAIR|locus:2135555 | 129 | AT4G12520 [Arabidopsis thalian | 0.389 | 0.682 | 0.516 | 3.1e-19 |
| TAIR|locus:2203876 AT1G62500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 311 (114.5 bits), Expect = 8.2e-28, P = 8.2e-28
Identities = 56/91 (61%), Positives = 72/91 (79%)
Query: 135 QQKTCPINALKLSACVDVLGGLIQIGLGDSAKEKCCPLLHGLVDLDAAICLCTAIRIKAP 194
+Q TCPINALKL ACVDVLGGLI IGLG+ + CCP+L GL++L+AA+CLCT IR+K
Sbjct: 208 KQPTCPINALKLGACVDVLGGLIHIGLGNPVENVCCPVLQGLLELEAAVCLCTTIRLKLL 267
Query: 195 NLINLLVPISLQVLVNDCGKYPPAGFQCPPI 225
NL N+ +P++LQ L+ CG PP+GF CPP+
Sbjct: 268 NL-NIFIPLALQALIT-CGINPPSGFVCPPL 296
|
|
| TAIR|locus:4010713767 AT3G22142 "AT3G22142" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090419 CWLP "cell wall-plasma membrane linker protein" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2041927 AT2G10940 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135595 AZI1 "azelaic acid induced 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135610 EARLI1 "EARLY ARABIDOPSIS ALUMINUM INDUCED 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135635 AT4G12500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135625 AT4G12490 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135545 AT4G12510 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135555 AT4G12520 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 226 | |||
| cd01958 | 85 | cd01958, HPS_like, HPS_like: Hydrophobic Protein f | 6e-27 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 9e-11 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-10 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-10 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-10 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-10 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 3e-10 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 5e-10 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-09 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-09 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-09 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-09 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 7e-09 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 7e-09 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-08 | |
| pfam00234 | 74 | pfam00234, Tryp_alpha_amyl, Protease inhibitor/see | 1e-08 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-08 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-08 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-08 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 3e-08 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 3e-08 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 3e-08 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-08 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 5e-08 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-08 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 7e-08 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 7e-08 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 1e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-07 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-07 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-07 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-07 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 3e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-07 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 3e-07 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 3e-07 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 3e-07 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 3e-07 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 3e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-07 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 6e-07 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 6e-07 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 7e-07 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 7e-07 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 8e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 1e-06 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 1e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 1e-06 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 1e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-06 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-06 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 2e-06 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 2e-06 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 2e-06 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 2e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 3e-06 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 4e-06 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 4e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 5e-06 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 5e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 6e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 7e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 8e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 1e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 1e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 1e-05 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 1e-05 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 1e-05 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-05 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-05 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 2e-05 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 2e-05 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 2e-05 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 3e-05 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 3e-05 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 3e-05 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 3e-05 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 3e-05 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 3e-05 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 3e-05 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 4e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 4e-05 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 4e-05 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 4e-05 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 4e-05 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 4e-05 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 4e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-05 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 5e-05 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 5e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 5e-05 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 6e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 6e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 6e-05 | |
| pfam10428 | 419 | pfam10428, SOG2, RAM signalling pathway protein | 6e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 7e-05 | |
| PHA03132 | 580 | PHA03132, PHA03132, thymidine kinase; Provisional | 7e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 8e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 8e-05 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 8e-05 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 9e-05 | |
| PTZ00449 | 943 | PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti | 9e-05 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 1e-04 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 1e-04 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 1e-04 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 1e-04 | |
| PRK09752 | 1250 | PRK09752, PRK09752, adhesin; Provisional | 1e-04 | |
| pfam02993 | 238 | pfam02993, MCPVI, Minor capsid protein VI | 1e-04 | |
| PLN02258 | 590 | PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen | 1e-04 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-04 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 2e-04 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 2e-04 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 2e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 3e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 3e-04 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 3e-04 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 3e-04 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 3e-04 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 3e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 4e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 4e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 4e-04 | |
| PLN02769 | 629 | PLN02769, PLN02769, Probable galacturonosyltransfe | 4e-04 | |
| pfam06070 | 777 | pfam06070, Herpes_UL32, Herpesvirus large structur | 4e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-04 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 5e-04 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 5e-04 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 5e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 5e-04 | |
| PHA03369 | 663 | PHA03369, PHA03369, capsid maturational protease; | 5e-04 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 6e-04 | |
| PRK09752 | 1250 | PRK09752, PRK09752, adhesin; Provisional | 6e-04 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 6e-04 | |
| COG3115 | 324 | COG3115, ZipA, Cell division protein [Cell divisio | 6e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 7e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 7e-04 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 7e-04 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 7e-04 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 7e-04 | |
| PRK09424 | 509 | PRK09424, pntA, NAD(P) transhydrogenase subunit al | 7e-04 | |
| PRK00708 | 209 | PRK00708, PRK00708, sec-independent translocase; P | 7e-04 | |
| PRK10819 | 246 | PRK10819, PRK10819, transport protein TonB; Provis | 7e-04 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 8e-04 | |
| TIGR02784 | 1135 | TIGR02784, addA_alphas, double-strand break repair | 8e-04 | |
| PRK12757 | 256 | PRK12757, PRK12757, cell division protein FtsN; Pr | 9e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 0.001 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.001 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 0.001 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 0.001 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 0.001 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 0.001 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.001 | |
| PTZ00449 | 943 | PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti | 0.001 | |
| PRK00095 | 617 | PRK00095, mutL, DNA mismatch repair protein; Revie | 0.001 | |
| COG5373 | 931 | COG5373, COG5373, Predicted membrane protein [Func | 0.001 | |
| PRK14963 | 504 | PRK14963, PRK14963, DNA polymerase III subunits ga | 0.001 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.002 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.002 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.002 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 0.002 | |
| pfam06070 | 777 | pfam06070, Herpes_UL32, Herpesvirus large structur | 0.002 | |
| PRK14963 | 504 | PRK14963, PRK14963, DNA polymerase III subunits ga | 0.002 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 0.002 | |
| PRK13042 | 291 | PRK13042, PRK13042, superantigen-like protein; Rev | 0.002 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 0.002 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 0.002 | |
| PRK15313 | 955 | PRK15313, PRK15313, autotransport protein MisL; Pr | 0.002 | |
| PRK15313 | 955 | PRK15313, PRK15313, autotransport protein MisL; Pr | 0.002 | |
| PTZ00436 | 357 | PTZ00436, PTZ00436, 60S ribosomal protein L19-like | 0.002 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 0.002 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.003 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.003 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.003 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 0.003 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 0.003 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.003 | |
| PHA03132 | 580 | PHA03132, PHA03132, thymidine kinase; Provisional | 0.003 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 0.003 | |
| PRK06975 | 656 | PRK06975, PRK06975, bifunctional uroporphyrinogen- | 0.003 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 0.003 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 0.003 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 0.003 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 0.003 | |
| PRK12438 | 991 | PRK12438, PRK12438, hypothetical protein; Provisio | 0.003 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.004 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 0.004 | |
| PRK09752 | 1250 | PRK09752, PRK09752, adhesin; Provisional | 0.004 | |
| PRK12757 | 256 | PRK12757, PRK12757, cell division protein FtsN; Pr | 0.004 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 0.004 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 0.004 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 0.004 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 0.004 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 0.004 |
| >gnl|CDD|238924 cd01958, HPS_like, HPS_like: Hydrophobic Protein from Soybean (HPS)-like subfamily; composed of proteins with similarity to HPS, a small hydrophobic protein with unknown function related to cereal-type alpha-amylase inhibitors and lipid transfer proteins | Back alignment and domain information |
|---|
Score = 98.6 bits (246), Expect = 6e-27
Identities = 42/85 (49%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
Query: 138 TCPINALKLSACVDVLGGLIQIGLGDSAKEKCCPLLHGLVDLDAAICLCTAIRIKAPNLI 197
TCP +ALKL C +VLG + + LG A + CCPL+ GL DLDAA+CLCTAI+ I
Sbjct: 3 TCPRDALKLGVCANVLGLSL-LLLGTPAVQPCCPLIGGLADLDAAVCLCTAIKANILG-I 60
Query: 198 NLLVPISLQVLVNDCGKYPPAGFQC 222
++ +P++L +L+N CG+ P GF C
Sbjct: 61 SINIPVALSLLLNSCGRNVPPGFTC 85
|
In addition to HPS, members of this subfamily include a hybrid proline-rich protein (HyPRP) from maize, a dark-inducible protein (LeDI-2) from Lithospermum erythrorhizon, maize ZRP3 protein, and rice RcC3 protein. HyPRP is an embryo-specific protein that contains an N-terminal proline-rich domain and a C-terminal HPS-like cysteine-rich domain. It has been suggested that HyPRP may be involved in the stability and defense of the developing embryo. LeDI-2 is a root-specific protein that may be involved in regulating the biosynthesis of shikonin derivatives in L. erythrorhizon. Maize ZRP3 and rice RcC3 are root-specific proteins whose functions are yet to be determined. It has been reported that ZRP3 largely accumulates in a distinct subset of cortical cells. Length = 85 |
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215810 pfam00234, Tryp_alpha_amyl, Protease inhibitor/seed storage/LTP family | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220749 pfam10428, SOG2, RAM signalling pathway protein | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182059 PRK09752, PRK09752, adhesin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217310 pfam02993, MCPVI, Minor capsid protein VI | Back alignment and domain information |
|---|
| >gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215412 PLN02769, PLN02769, Probable galacturonosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|218881 pfam06070, Herpes_UL32, Herpesvirus large structural phosphoprotein UL32 | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223061 PHA03369, PHA03369, capsid maturational protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|182059 PRK09752, PRK09752, adhesin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|225657 COG3115, ZipA, Cell division protein [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|236507 PRK09424, pntA, NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234818 PRK00708, PRK00708, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234012 TIGR02784, addA_alphas, double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234630 PRK00095, mutL, DNA mismatch repair protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218881 pfam06070, Herpes_UL32, Herpesvirus large structural phosphoprotein UL32 | Back alignment and domain information |
|---|
| >gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|183854 PRK13042, PRK13042, superantigen-like protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|171499 PRK12438, PRK12438, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182059 PRK09752, PRK09752, adhesin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 226 | |||
| PF14547 | 85 | Hydrophob_seed: Hydrophobic seed protein | 100.0 | |
| cd01958 | 85 | HPS_like HPS_like: Hydrophobic Protein from Soybea | 100.0 | |
| smart00499 | 79 | AAI Plant lipid transfer protein / seed storage pr | 97.08 | |
| PF14368 | 96 | LTP_2: Probable lipid transfer; PDB: 2RKN_A 1N89_A | 96.97 | |
| cd04660 | 73 | nsLTP_like nsLTP_like: Non-specific lipid-transfer | 96.94 | |
| cd01959 | 66 | nsLTP2 nsLTP2: Non-specific lipid-transfer protein | 96.88 | |
| cd00010 | 63 | AAI_LTSS AAI_LTSS: Alpha-Amylase Inhibitors (AAI), | 94.6 | |
| PF00234 | 90 | Tryp_alpha_amyl: Protease inhibitor/seed storage/L | 94.08 | |
| cd01960 | 89 | nsLTP1 nsLTP1: Non-specific lipid-transfer protein | 93.19 |
| >PF14547 Hydrophob_seed: Hydrophobic seed protein | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-34 Score=220.74 Aligned_cols=85 Identities=52% Similarity=1.117 Sum_probs=83.1
Q ss_pred CCCccccCccccccccccccccccCCCCCCCCchhhcCCcccccchhhhHHhhhccCceeccccchhhHHhhhhcCCCCC
Q 040356 138 TCPINALKLSACVDVLGGLIQIGLGDSAKEKCCPLLHGLVDLDAAICLCTAIRIKAPNLINLLVPISLQVLVNDCGKYPP 217 (226)
Q Consensus 138 ~CP~DaLKLgvCanVLgGLv~~~lG~Pp~~~CCpLI~GLaDldAAvCLCtAIKAnvLGlInlniPi~L~lLLN~CGK~vP 217 (226)
+||+|++||++|+||| ||+++.+|++.+++||++|+||+|+|||+|||+|||+|+||+||+|||+++++|+|.|||++|
T Consensus 1 ~CP~d~lkLgvC~~vL-~l~~~~~g~~~~~~CC~li~gL~d~~AA~CLC~aika~vlg~i~~~ipv~l~~lln~CGk~~p 79 (85)
T PF14547_consen 1 TCPRDALKLGVCANVL-GLVNLVIGNPPRQPCCSLIAGLADLDAAVCLCTAIKANVLGLINVNIPVALNLLLNACGKTVP 79 (85)
T ss_pred CCCCcchhhhhhhhhh-hhhccccCCCCCCCcChHHhCcccchHHHHHHHHHhhhcccccccccccHHHHHHHHhCCcCc
Confidence 6999999999999999 799999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCcCC
Q 040356 218 AGFQCP 223 (226)
Q Consensus 218 ~GF~C~ 223 (226)
+||+|+
T Consensus 80 ~gf~C~ 85 (85)
T PF14547_consen 80 SGFTCP 85 (85)
T ss_pred CCCcCC
Confidence 999996
|
|
| >cd01958 HPS_like HPS_like: Hydrophobic Protein from Soybean (HPS)-like subfamily; composed of proteins with similarity to HPS, a small hydrophobic protein with unknown function related to cereal-type alpha-amylase inhibitors and lipid transfer proteins | Back alignment and domain information |
|---|
| >smart00499 AAI Plant lipid transfer protein / seed storage protein / trypsin-alpha amylase inhibitor domain family | Back alignment and domain information |
|---|
| >PF14368 LTP_2: Probable lipid transfer; PDB: 2RKN_A 1N89_A 1TUK_A | Back alignment and domain information |
|---|
| >cd04660 nsLTP_like nsLTP_like: Non-specific lipid-transfer protein (nsLTP)-like subfamily; composed of predominantly uncharacterized proteins with similarity to nsLTPs, including Medicago truncatula MtN5, the root-specific Phaseolus vulgaris PVR3, Antirrhinum majus FIL1, and Lilium longiflorum LIM3 | Back alignment and domain information |
|---|
| >cd01959 nsLTP2 nsLTP2: Non-specific lipid-transfer protein type 2 (nsLTP2) subfamily; Plant nsLTPs are small, soluble proteins that facilitate the transfer of fatty acids, phospholipids, glycolipids, and steroids between membranes | Back alignment and domain information |
|---|
| >cd00010 AAI_LTSS AAI_LTSS: Alpha-Amylase Inhibitors (AAI), Lipid Transfer (LT) and Seed Storage (SS) Protein family; a protein family unique to higher plants that includes cereal-type alpha-amylase inhibitors, lipid transfer proteins, seed storage proteins, and similar proteins | Back alignment and domain information |
|---|
| >PF00234 Tryp_alpha_amyl: Protease inhibitor/seed storage/LTP family This is a small subfamily; InterPro: IPR003612 This domain is found is several proteins, including plant lipid transfer proteins [], seed storage proteins [] and trypsin-alpha amylase inhibitors [, ] | Back alignment and domain information |
|---|
| >cd01960 nsLTP1 nsLTP1: Non-specific lipid-transfer protein type 1 (nsLTP1) subfamily; Plant nsLTPs are small, soluble proteins that facilitate the transfer of fatty acids, phospholipids, glycolipids, and steroids between membranes | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 226 | ||||
| 1hyp_A | 80 | Crystal Structure Of Hydrophobic Protein From Soybe | 7e-06 |
| >pdb|1HYP|A Chain A, Crystal Structure Of Hydrophobic Protein From Soybean; A Member Of A New Cystine-Rich Family Length = 80 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 226 | |||
| 1hyp_A | 80 | Hydrophobic protein from soybean; hydrophobic SEED | 2e-19 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 2e-13 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 3e-13 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 2e-12 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 4e-11 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 7e-10 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 3e-08 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 7e-08 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 3e-10 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 4e-10 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 1e-09 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 1e-07 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 2e-06 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 6e-06 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 8e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 6e-10 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 1e-06 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 3e-04 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 8e-10 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 1e-05 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 2e-05 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 1e-04 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 2e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-09 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 9e-09 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-08 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 5e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 4e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-04 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 6e-07 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 9e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 1e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 1e-06 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 1e-06 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 1e-04 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 2e-04 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 4e-04 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 3e-05 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 7e-05 | |
| 1x9d_A | 538 | Endoplasmic reticulum mannosyl-oligosaccharide 1, | 3e-05 | |
| 1x9d_A | 538 | Endoplasmic reticulum mannosyl-oligosaccharide 1, | 5e-05 | |
| 1x9d_A | 538 | Endoplasmic reticulum mannosyl-oligosaccharide 1, | 5e-04 | |
| 1x9d_A | 538 | Endoplasmic reticulum mannosyl-oligosaccharide 1, | 5e-04 | |
| 1x9d_A | 538 | Endoplasmic reticulum mannosyl-oligosaccharide 1, | 7e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 5e-05 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 3e-04 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 8e-05 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 9e-05 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 1e-04 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 2e-04 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 7e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 1e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 3e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 4e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 8e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 8e-04 | |
| 2wd6_A | 349 | Agglutinin receptor; cell adhesion, secreted, V-re | 1e-04 | |
| 2wd6_A | 349 | Agglutinin receptor; cell adhesion, secreted, V-re | 2e-04 | |
| 2wd6_A | 349 | Agglutinin receptor; cell adhesion, secreted, V-re | 4e-04 | |
| 2wd6_A | 349 | Agglutinin receptor; cell adhesion, secreted, V-re | 6e-04 | |
| 2wd6_A | 349 | Agglutinin receptor; cell adhesion, secreted, V-re | 6e-04 | |
| 2wd6_A | 349 | Agglutinin receptor; cell adhesion, secreted, V-re | 8e-04 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 1e-04 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 2e-04 | |
| 1zvo_C | 512 | Myeloma immunoglobulin D delta; immunoglobulin fol | 2e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 2e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 4e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 5e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 6e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 4e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 5e-04 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 7e-04 |
| >1hyp_A Hydrophobic protein from soybean; hydrophobic SEED protein; 1.80A {Glycine max} SCOP: a.52.1.1 Length = 80 | Back alignment and structure |
|---|
Score = 78.4 bits (193), Expect = 2e-19
Identities = 28/88 (31%), Positives = 50/88 (56%), Gaps = 14/88 (15%)
Query: 136 QKTCPINALKLSACVDVLGGLIQIGLGDSAKEKCCPLLHGLVDLDAAICLCTAIRIKAPN 195
+ +CP LS C+++LGG + + CC L+ GL D++A +CLC ++A
Sbjct: 5 RPSCP----DLSICLNILGGSL------GTVDDCCALIGGLGDIEAIVCLCIQ--LRALG 52
Query: 196 LINLLVPISLQVLVNDCGKYPPAGFQCP 223
++N + +LQ+++N CG+ P+ CP
Sbjct: 53 ILN--LNRNLQLILNSCGRSYPSNATCP 78
|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
| >1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 | Back alignment and structure |
|---|
| >1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 | Back alignment and structure |
|---|
| >1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 | Back alignment and structure |
|---|
| >1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 | Back alignment and structure |
|---|
| >1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2wd6_A Agglutinin receptor; cell adhesion, secreted, V-region, cell WALL, AG I/II protei surface adhesin, peptidoglycan-anchor; 2.30A {Streptococcus gordonii} Length = 349 | Back alignment and structure |
|---|
| >2wd6_A Agglutinin receptor; cell adhesion, secreted, V-region, cell WALL, AG I/II protei surface adhesin, peptidoglycan-anchor; 2.30A {Streptococcus gordonii} Length = 349 | Back alignment and structure |
|---|
| >2wd6_A Agglutinin receptor; cell adhesion, secreted, V-region, cell WALL, AG I/II protei surface adhesin, peptidoglycan-anchor; 2.30A {Streptococcus gordonii} Length = 349 | Back alignment and structure |
|---|
| >2wd6_A Agglutinin receptor; cell adhesion, secreted, V-region, cell WALL, AG I/II protei surface adhesin, peptidoglycan-anchor; 2.30A {Streptococcus gordonii} Length = 349 | Back alignment and structure |
|---|
| >2wd6_A Agglutinin receptor; cell adhesion, secreted, V-region, cell WALL, AG I/II protei surface adhesin, peptidoglycan-anchor; 2.30A {Streptococcus gordonii} Length = 349 | Back alignment and structure |
|---|
| >2wd6_A Agglutinin receptor; cell adhesion, secreted, V-region, cell WALL, AG I/II protei surface adhesin, peptidoglycan-anchor; 2.30A {Streptococcus gordonii} Length = 349 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Length = 512 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Length = 574 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 226 | |||
| 1hyp_A | 80 | Hydrophobic protein from soybean; hydrophobic SEED | 99.95 | |
| 1n89_A | 67 | Lipid transfer protein; lipid transport; HET: PGM; | 96.78 | |
| 1l6h_A | 69 | LTP2, non-specific lipid transfer protein; NSLTP2, | 96.59 | |
| 2rkn_A | 77 | DIR1 protein, AT5G48485; LTP, defense signaling pr | 95.83 | |
| 1siy_A | 91 | LTP 1, NS-LTP1, nonspecific lipid-transfer protein | 95.46 | |
| 2ljo_A | 93 | Non-specific lipid-transfer protein 2; lipid trans | 94.87 | |
| 2alg_A | 92 | Non-specific lipid transfer protein; LTP, NS-LTP, | 94.37 | |
| 1bwo_A | 90 | NS-LTP1, nonspecific lipid-transfer protein; wheat | 93.95 | |
| 1afh_A | 93 | Maize nonspecific lipid transfer protein; lipid-bi | 93.45 | |
| 1t12_A | 91 | LTP 1, nonspecific lipid-transfer protein 1; cyste | 92.46 |
| >1hyp_A Hydrophobic protein from soybean; hydrophobic SEED protein; 1.80A {Glycine max} SCOP: a.52.1.1 | Back alignment and structure |
|---|
Probab=99.95 E-value=2.4e-29 Score=190.51 Aligned_cols=75 Identities=41% Similarity=0.978 Sum_probs=67.1
Q ss_pred CCCCCccccCccccccccccccccccCCCCCCCCchhhcCCcccccchhhhHHhhhccCceeccccchhhHHhhhhcCCC
Q 040356 136 QKTCPINALKLSACVDVLGGLIQIGLGDSAKEKCCPLLHGLVDLDAAICLCTAIRIKAPNLINLLVPISLQVLVNDCGKY 215 (226)
Q Consensus 136 ~~~CP~DaLKLgvCanVLgGLv~~~lG~Pp~~~CCpLI~GLaDldAAvCLCtAIKAnvLGlInlniPi~L~lLLN~CGK~ 215 (226)
+++|| |||+|+|||||++ | ++++||++|+||+|+|||+||||||| +|| | +|||++|++|+|.|||+
T Consensus 5 ~~~CP----kLgvCanvL~g~~----~--~~~~CC~Ll~GL~dleAAvCLCtaik--~Lg-i-lnlpv~L~llln~Cgk~ 70 (80)
T 1hyp_A 5 RPSCP----DLSICLNILGGSL----G--TVDDCCALIGGLGDIEAIVCLCIQLR--ALG-I-LNLNRNLQLILNSCGRS 70 (80)
T ss_dssp -CCSC----CCGGGGGGGGTCC----T--THHHHHHHHHTSCHHHHHHHHHHHHH--HHT-C-SCHHHHHHHHHHHTTCS
T ss_pred CCCCC----chhHHHHHhCcCC----C--CCCccchhhhCcchhhhhhhhhhhcc--ccc-e-eecChhHHHHHHHhCCc
Confidence 35799 8999999998653 2 56789999999999999999999999 489 6 88899999999999999
Q ss_pred CCCCCcCCC
Q 040356 216 PPAGFQCPP 224 (226)
Q Consensus 216 vP~GF~C~~ 224 (226)
+|+||+|+.
T Consensus 71 ~P~gF~C~~ 79 (80)
T 1hyp_A 71 YPSNATCPR 79 (80)
T ss_dssp SCCCCCCSC
T ss_pred CcCCCCCCC
Confidence 999999975
|
| >1n89_A Lipid transfer protein; lipid transport; HET: PGM; NMR {Triticum turgidum subsp} SCOP: a.52.1.1 PDB: 1tuk_A* | Back alignment and structure |
|---|
| >1l6h_A LTP2, non-specific lipid transfer protein; NSLTP2, plant LTP, lipid transport; NMR {Oryza sativa} SCOP: a.52.1.1 | Back alignment and structure |
|---|
| >2rkn_A DIR1 protein, AT5G48485; LTP, defense signaling protein, signaling protein, lipid TRA; HET: LP3; 1.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1siy_A LTP 1, NS-LTP1, nonspecific lipid-transfer protein 1; alpha helix, lipid binding protein; NMR {Vigna radiata var} | Back alignment and structure |
|---|
| >2ljo_A Non-specific lipid-transfer protein 2; lipid transport; NMR {Lens culinaris} | Back alignment and structure |
|---|
| >2alg_A Non-specific lipid transfer protein; LTP, NS-LTP, FOOD allergen, lipid transport; HET: DAO P6G; 2.30A {Prunus persica} PDB: 2b5s_A* | Back alignment and structure |
|---|
| >1bwo_A NS-LTP1, nonspecific lipid-transfer protein; wheat, lipid binding, crystallography; HET: LPC; 2.10A {Triticum aestivum} SCOP: a.52.1.1 PDB: 1cz2_A* 1gh1_A 1be2_A* 1jtb_A* 1lip_A 1mid_A* 3cee_A* 3gsh_A* | Back alignment and structure |
|---|
| >1afh_A Maize nonspecific lipid transfer protein; lipid-binding protein, molecular modeling,; NMR {Zea mays} SCOP: a.52.1.1 PDB: 1fk0_A* 1fk1_A* 1fk2_A* 1fk3_A* 1fk4_A* 1fk5_A* 1fk6_A* 1fk7_A* 1mzl_A 1mzm_A* 1bv2_A 1rzl_A* 1uva_A* 1uvb_A* 1uvc_A* | Back alignment and structure |
|---|
| >1t12_A LTP 1, nonspecific lipid-transfer protein 1; cystein rich protein, lipid transport; NMR {Nicotiana tabacum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 226 | ||||
| d1hypa_ | 75 | a.52.1.1 (A:) Soybean hydrophobic protein {Soybean | 3e-21 | |
| d1jmma_ | 377 | b.30.6.1 (A:) V-region of surface antigen I/II (SA | 0.001 |
| >d1hypa_ a.52.1.1 (A:) Soybean hydrophobic protein {Soybean (Glycine max) [TaxId: 3847]} Length = 75 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin family: Plant lipid-transfer and hydrophobic proteins domain: Soybean hydrophobic protein species: Soybean (Glycine max) [TaxId: 3847]
Score = 82.1 bits (203), Expect = 3e-21
Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 14/86 (16%)
Query: 138 TCPINALKLSACVDVLGGLIQIGLGDSAKEKCCPLLHGLVDLDAAICLCTAIRIKAPNLI 197
+CP LS C+++LGG + + CC L+ GL D++A +CLC +R L
Sbjct: 2 SCP----DLSICLNILGGSLG------TVDDCCALIGGLGDIEAIVCLCIQLRA----LG 47
Query: 198 NLLVPISLQVLVNDCGKYPPAGFQCP 223
L + +LQ+++N CG+ P+ CP
Sbjct: 48 ILNLNRNLQLILNSCGRSYPSNATCP 73
|
| >d1jmma_ b.30.6.1 (A:) V-region of surface antigen I/II (SA I/II, PAC) {Streptococcus mutans [TaxId: 1309]} Length = 377 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 226 | |||
| d1hypa_ | 75 | Soybean hydrophobic protein {Soybean (Glycine max) | 99.95 | |
| d1fk5a_ | 93 | Plant non-specific lipid-transfer protein (ns-LTP, | 95.62 | |
| d1mida_ | 91 | Plant non-specific lipid-transfer protein (ns-LTP, | 94.26 | |
| d1tuka1 | 67 | Non-specific lipid-transfer protein homologue (ns- | 94.0 | |
| d1l6ha_ | 69 | Non-specific lipid-transfer protein homologue (ns- | 92.53 |
| >d1hypa_ a.52.1.1 (A:) Soybean hydrophobic protein {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin family: Plant lipid-transfer and hydrophobic proteins domain: Soybean hydrophobic protein species: Soybean (Glycine max) [TaxId: 3847]
Probab=99.95 E-value=1.2e-29 Score=188.58 Aligned_cols=74 Identities=39% Similarity=0.938 Sum_probs=66.1
Q ss_pred CCCCccccCccccccccccccccccCCCCCCCCchhhcCCcccccchhhhHHhhhccCceeccccchhhHHhhhhcCCCC
Q 040356 137 KTCPINALKLSACVDVLGGLIQIGLGDSAKEKCCPLLHGLVDLDAAICLCTAIRIKAPNLINLLVPISLQVLVNDCGKYP 216 (226)
Q Consensus 137 ~~CP~DaLKLgvCanVLgGLv~~~lG~Pp~~~CCpLI~GLaDldAAvCLCtAIKAnvLGlInlniPi~L~lLLN~CGK~v 216 (226)
.+|| |||+|+|||||+++ ..++||++|+||+|+|||+||||||||++ | +||||+|++|+|.|||++
T Consensus 1 PtCP----Klg~C~nvLg~~~~------~~~~CC~Ll~GL~dleAAvCLCtaika~~---l-lnvpv~l~llln~Cgk~~ 66 (75)
T d1hypa_ 1 PSCP----DLSICLNILGGSLG------TVDDCCALIGGLGDIEAIVCLCIQLRALG---I-LNLNRNLQLILNSCGRSY 66 (75)
T ss_dssp CCSC----CCGGGGGGGGTCCT------THHHHHHHHHTSCHHHHHHHHHHHHHHHT---C-SCHHHHHHHHHHHTTCSS
T ss_pred CCCC----chhhHHHHhcCccC------CCCCcchHHhhHHHHHHHHHHHHHHHHhh---h-ccccchHHHHHHHcCCcC
Confidence 3799 89999999997753 45789999999999999999999999954 3 678899999999999999
Q ss_pred CCCCcCCC
Q 040356 217 PAGFQCPP 224 (226)
Q Consensus 217 P~GF~C~~ 224 (226)
|+||+|++
T Consensus 67 P~gF~CP~ 74 (75)
T d1hypa_ 67 PSNATCPR 74 (75)
T ss_dssp CCCCCCSC
T ss_pred cCCCcCCC
Confidence 99999986
|
| >d1fk5a_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1mida_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1tuka1 a.52.1.1 (A:1-67) Non-specific lipid-transfer protein homologue (ns-LTP2) {Triticum turgidum [TaxId: 4571]} | Back information, alignment and structure |
|---|
| >d1l6ha_ a.52.1.1 (A:) Non-specific lipid-transfer protein homologue (ns-LTP2) {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|