Citrus Sinensis ID: 040426

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MADPLGRDFLFCKFCGTMLRMESNHVVCSSCKFKKNVQDVADREISYAVTAEEIKRELGISLFEQPQGDKGETQLSKVKRACEKCQNPEMYYSTRQTRSADEGQTTYYICPRCGHRCQES
ccccccccccccccccccCECcccEEEccccccEEEcccccccEEEEEEEHHHHHHHHccCEEccccccccccccccccccccccccccEEEEEEEccccccccEEEEEccccccEEccc
****LGRDFLFCKFCGTMLRMESNHVVCSSCKFKKNVQDVADREISYAVTAEEIKRELGISLF*************KVKRACEKCQNPEMYYSTRQTRSADEGQTTYYICPRCGHRC***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADPLGRDFLFCKFCGTMLRMESNHVVCSSCKFKKNVQDVADREISYAVTAEEIKRELGISLFEQPQGDKGETQLSKVKRACEKCQNPEMYYSTRQTRSADEGQTTYYICPRCGHRCQES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA-directed RNA polymerase I subunit RPA12 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Involved in transcriptional termination. Involved in recruitment of RPA49 to Pol I.probableP32529
DNA-directed RNA polymerase subunit M DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.probableO27369
DNA-directed RNA polymerase I subunit RPA12 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors.probableQ5TM50

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QT1, chain I
Confidence level:very confident
Coverage over the Query: 7-51
View the alignment between query and template
View the model in PyMOL