Citrus Sinensis ID: 040426
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 120 | ||||||
| 18404735 | 119 | TFIIB zinc-binding protein [Arabidopsis | 0.916 | 0.924 | 0.575 | 2e-31 | |
| 297814818 | 119 | transcription factor S-II domain-contain | 0.908 | 0.915 | 0.562 | 6e-30 | |
| 312281609 | 119 | unnamed protein product [Thellungiella h | 0.9 | 0.907 | 0.566 | 7e-29 | |
| 357465637 | 115 | DNA-directed RNA polymerase I subunit RP | 0.916 | 0.956 | 0.543 | 8e-28 | |
| 449450514 | 116 | PREDICTED: DNA-directed RNA polymerase I | 0.958 | 0.991 | 0.504 | 2e-26 | |
| 168480799 | 116 | TFIIS domain-containing protein [Cucumis | 0.9 | 0.931 | 0.517 | 1e-24 | |
| 224123076 | 117 | predicted protein [Populus trichocarpa] | 0.966 | 0.991 | 0.471 | 1e-23 | |
| 351723413 | 116 | uncharacterized protein LOC100527489 [Gl | 0.908 | 0.939 | 0.482 | 2e-23 | |
| 302142695 | 126 | unnamed protein product [Vitis vinifera] | 1.0 | 0.952 | 0.456 | 4e-22 | |
| 326511037 | 125 | predicted protein [Hordeum vulgare subsp | 1.0 | 0.96 | 0.467 | 2e-21 |
| >gi|18404735|ref|NP_566786.1| TFIIB zinc-binding protein [Arabidopsis thaliana] gi|9279599|dbj|BAB01057.1| unnamed protein product [Arabidopsis thaliana] gi|21536551|gb|AAM60883.1| putative RNA polymerase I subunit [Arabidopsis thaliana] gi|88011125|gb|ABD38906.1| At3g25940 [Arabidopsis thaliana] gi|332643572|gb|AEE77093.1| TFIIB zinc-binding protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Score = 139 bits (350), Expect = 2e-31, Method: Compositional matrix adjust.
Identities = 65/113 (57%), Positives = 85/113 (75%), Gaps = 3/113 (2%)
Query: 8 DFLFCKFCGTMLRMESN-HVVCSSCKFKKNVQDVADREISYAVTAEEIKRELGISLFEQP 66
+FLFC CGTML ++S + C CK +N +D+ D+EI+Y V+AE+I+RELGISLF
Sbjct: 8 EFLFCNLCGTMLVLKSTKYAECPHCKTTRNAKDIIDKEIAYTVSAEDIRRELGISLF--G 65
Query: 67 QGDKGETQLSKVKRACEKCQNPEMYYSTRQTRSADEGQTTYYICPRCGHRCQE 119
+ + E +L K+K+ACEKCQ+PE+ Y+TRQTRSADEGQTTYY CP C HR E
Sbjct: 66 EKTQAEAELPKIKKACEKCQHPELVYTTRQTRSADEGQTTYYTCPNCAHRFTE 118
|
Source: Arabidopsis thaliana Species: Arabidopsis thaliana Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297814818|ref|XP_002875292.1| transcription factor S-II domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297321130|gb|EFH51551.1| transcription factor S-II domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|312281609|dbj|BAJ33670.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|357465637|ref|XP_003603103.1| DNA-directed RNA polymerase I subunit RPA12 [Medicago truncatula] gi|357470681|ref|XP_003605625.1| DNA-directed RNA polymerase I subunit RPA12 [Medicago truncatula] gi|355492151|gb|AES73354.1| DNA-directed RNA polymerase I subunit RPA12 [Medicago truncatula] gi|355506680|gb|AES87822.1| DNA-directed RNA polymerase I subunit RPA12 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449450514|ref|XP_004143007.1| PREDICTED: DNA-directed RNA polymerase I subunit RPA12-like isoform 1 [Cucumis sativus] gi|449450516|ref|XP_004143008.1| PREDICTED: DNA-directed RNA polymerase I subunit RPA12-like isoform 2 [Cucumis sativus] gi|449450518|ref|XP_004143009.1| PREDICTED: DNA-directed RNA polymerase I subunit RPA12-like isoform 3 [Cucumis sativus] gi|449500372|ref|XP_004161079.1| PREDICTED: DNA-directed RNA polymerase I subunit RPA12-like isoform 1 [Cucumis sativus] gi|449500375|ref|XP_004161080.1| PREDICTED: DNA-directed RNA polymerase I subunit RPA12-like isoform 2 [Cucumis sativus] gi|449500379|ref|XP_004161081.1| PREDICTED: DNA-directed RNA polymerase I subunit RPA12-like isoform 3 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|168480799|gb|ACA24493.1| TFIIS domain-containing protein [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224123076|ref|XP_002318989.1| predicted protein [Populus trichocarpa] gi|222857365|gb|EEE94912.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|351723413|ref|NP_001236766.1| uncharacterized protein LOC100527489 [Glycine max] gi|255632466|gb|ACU16583.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|302142695|emb|CBI19898.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|326511037|dbj|BAJ91866.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 120 | ||||||
| TAIR|locus:2092185 | 119 | AT3G25940 [Arabidopsis thalian | 0.916 | 0.924 | 0.575 | 4.1e-33 | |
| UNIPROTKB|B6ICU4 | 123 | ZNRD1 "DNA-directed RNA polyme | 0.841 | 0.821 | 0.361 | 1.3e-13 | |
| UNIPROTKB|Q1RMP0 | 123 | ZNRD1 "DNA-directed RNA polyme | 0.841 | 0.821 | 0.361 | 4.4e-13 | |
| UNIPROTKB|Q9P1U0 | 126 | ZNRD1 "DNA-directed RNA polyme | 0.841 | 0.801 | 0.361 | 9.1e-13 | |
| MGI|MGI:1913386 | 123 | Znrd1 "zinc ribbon domain cont | 0.841 | 0.821 | 0.351 | 9.1e-13 | |
| RGD|1303114 | 123 | Znrd1 "zinc ribbon domain cont | 0.841 | 0.821 | 0.351 | 1.9e-12 | |
| ZFIN|ZDB-GENE-050320-131 | 126 | znrd1 "zinc ribbon domain cont | 0.883 | 0.841 | 0.342 | 3.1e-12 | |
| DICTYBASE|DDB_G0278263 | 324 | rpa12 "RNA polymerase I subuni | 0.825 | 0.305 | 0.339 | 1.2e-11 | |
| CGD|CAL0006382 | 123 | RPA12 [Candida albicans (taxid | 0.85 | 0.829 | 0.327 | 3.5e-11 | |
| UNIPROTKB|F1PIF7 | 126 | ZNRD1 "DNA-directed RNA polyme | 0.875 | 0.833 | 0.342 | 3.5e-11 |
| TAIR|locus:2092185 AT3G25940 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 361 (132.1 bits), Expect = 4.1e-33, P = 4.1e-33
Identities = 65/113 (57%), Positives = 85/113 (75%)
Query: 8 DFLFCKFCGTMLRMESN-HVVCSSCKFKKNVQDVADREISYAVTAEEIKRELGISLFEQP 66
+FLFC CGTML ++S + C CK +N +D+ D+EI+Y V+AE+I+RELGISLF +
Sbjct: 8 EFLFCNLCGTMLVLKSTKYAECPHCKTTRNAKDIIDKEIAYTVSAEDIRRELGISLFGEK 67
Query: 67 QGDKGETQLSKVKRACEKCQNPEMYYSTRQTRSADEGQTTYYICPRCGHRCQE 119
+ E +L K+K+ACEKCQ+PE+ Y+TRQTRSADEGQTTYY CP C HR E
Sbjct: 68 T--QAEAELPKIKKACEKCQHPELVYTTRQTRSADEGQTTYYTCPNCAHRFTE 118
|
|
| UNIPROTKB|B6ICU4 ZNRD1 "DNA-directed RNA polymerase subunit" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q1RMP0 ZNRD1 "DNA-directed RNA polymerase I subunit RPA12" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9P1U0 ZNRD1 "DNA-directed RNA polymerase I subunit RPA12" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913386 Znrd1 "zinc ribbon domain containing, 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1303114 Znrd1 "zinc ribbon domain containing 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050320-131 znrd1 "zinc ribbon domain containing 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0278263 rpa12 "RNA polymerase I subunit" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0006382 RPA12 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PIF7 ZNRD1 "DNA-directed RNA polymerase subunit" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| AT3G25940 | transcription factor S-II (TFIIS) domain-containing protein; transcription factor S-II (TFIIS) domain-containing protein; FUNCTIONS IN- transcription factor activity, transcription regulator activity, DNA binding, zinc ion binding, nucleic acid binding; INVOLVED IN- RNA elongation, regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN- nucleus; EXPRESSED IN- 21 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- Zinc finger, TFIIS-type (InterPro-IPR001222); Has 677 Blast hits to 677 proteins in 189 species- Archae - 101; Bacte [...] (119 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| emb2742 | • | • | 0.907 | ||||||||
| AT4G13720 | • | • | • | 0.905 | |||||||
| AT5G14580 | • | • | 0.904 | ||||||||
| NDPK1 | • | • | 0.904 | ||||||||
| AT5G66005 | • | 0.899 | |||||||||
| AT5G63680 | • | 0.899 | |||||||||
| NDPK2 | • | 0.899 | |||||||||
| AT5G56350 | • | 0.899 | |||||||||
| PKP-BETA1 | • | 0.899 | |||||||||
| ATAPY2 | • | 0.899 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 120 | |||
| COG1594 | 113 | COG1594, RPB9, DNA-directed RNA polymerase, subuni | 4e-16 | |
| pfam01096 | 39 | pfam01096, TFIIS_C, Transcription factor S-II (TFI | 1e-12 | |
| TIGR01384 | 104 | TIGR01384, TFS_arch, transcription factor S, archa | 8e-11 | |
| smart00440 | 40 | smart00440, ZnF_C2C2, C2C2 Zinc finger | 3e-09 | |
| TIGR01385 | 299 | TIGR01385, TFSII, transcription elongation factor | 2e-05 |
| >gnl|CDD|224510 COG1594, RPB9, DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] | Back alignment and domain information |
|---|
Score = 68.3 bits (167), Expect = 4e-16
Identities = 36/112 (32%), Positives = 49/112 (43%), Gaps = 8/112 (7%)
Query: 9 FLFCKFCGTML----RMESNHVVCSSCKFKKNVQDVADREISYAVTAEEIKRELGISLFE 64
FC CG++L E +VC C +++ + S E+ K + + E
Sbjct: 2 MRFCPKCGSLLYPKKDDEGGKLVCRKCGYEEEASNKKVYRYSVKEAVEKKKEVVLVVEDE 61
Query: 65 QPQGDKGETQLSKVKRACEKCQNPEMYYSTRQTRSADEGQTTYYICPRCGHR 116
L K C KC N E YY QTRSADE +T +Y C RCG+R
Sbjct: 62 TQGA----KTLPTAKEKCPKCGNKEAYYWQLQTRSADEPETRFYKCTRCGYR 109
|
Length = 113 |
| >gnl|CDD|201594 pfam01096, TFIIS_C, Transcription factor S-II (TFIIS) | Back alignment and domain information |
|---|
| >gnl|CDD|130451 TIGR01384, TFS_arch, transcription factor S, archaeal | Back alignment and domain information |
|---|
| >gnl|CDD|128717 smart00440, ZnF_C2C2, C2C2 Zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|233390 TIGR01385, TFSII, transcription elongation factor S-II | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 120 | |||
| KOG2906 | 105 | consensus RNA polymerase III subunit C11 [Transcri | 100.0 | |
| COG1594 | 113 | RPB9 DNA-directed RNA polymerase, subunit M/Transc | 100.0 | |
| KOG2691 | 113 | consensus RNA polymerase II subunit 9 [Transcripti | 100.0 | |
| TIGR01384 | 104 | TFS_arch transcription factor S, archaeal. There h | 100.0 | |
| KOG2907 | 116 | consensus RNA polymerase I transcription factor TF | 100.0 | |
| smart00440 | 40 | ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding mo | 99.93 | |
| PF01096 | 39 | TFIIS_C: Transcription factor S-II (TFIIS); InterP | 99.92 | |
| PHA02998 | 195 | RNA polymerase subunit; Provisional | 99.85 | |
| TIGR01385 | 299 | TFSII transcription elongation factor S-II. This m | 99.72 | |
| PF02150 | 35 | RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I | 99.39 | |
| KOG1105 | 296 | consensus Transcription elongation factor TFIIS/Co | 99.04 | |
| smart00661 | 52 | RPOL9 RNA polymerase subunit 9. | 98.79 | |
| PRK00432 | 50 | 30S ribosomal protein S27ae; Validated | 98.21 | |
| COG1998 | 51 | RPS31 Ribosomal protein S27AE [Translation, riboso | 97.24 | |
| PF14803 | 34 | Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. | 97.24 | |
| PF04216 | 290 | FdhE: Protein involved in formate dehydrogenase fo | 97.2 | |
| PF04606 | 47 | Ogr_Delta: Ogr/Delta-like zinc finger; InterPro: I | 96.98 | |
| PRK03564 | 309 | formate dehydrogenase accessory protein FdhE; Prov | 96.98 | |
| PF08274 | 30 | PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 | 96.88 | |
| PHA00626 | 59 | hypothetical protein | 96.87 | |
| PF09297 | 32 | zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do | 96.78 | |
| PRK09678 | 72 | DNA-binding transcriptional regulator; Provisional | 96.75 | |
| PF09855 | 64 | DUF2082: Nucleic-acid-binding protein containing Z | 96.61 | |
| TIGR01562 | 305 | FdhE formate dehydrogenase accessory protein FdhE. | 96.54 | |
| smart00661 | 52 | RPOL9 RNA polymerase subunit 9. | 96.42 | |
| PHA00626 | 59 | hypothetical protein | 96.37 | |
| PF13717 | 36 | zinc_ribbon_4: zinc-ribbon domain | 96.12 | |
| PF12773 | 50 | DZR: Double zinc ribbon | 96.08 | |
| PF12760 | 46 | Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int | 95.95 | |
| PRK00464 | 154 | nrdR transcriptional regulator NrdR; Validated | 95.9 | |
| COG3478 | 68 | Predicted nucleic-acid-binding protein containing | 95.89 | |
| PF08271 | 43 | TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 | 95.74 | |
| PF14353 | 128 | CpXC: CpXC protein | 95.61 | |
| PF09538 | 108 | FYDLN_acid: Protein of unknown function (FYDLN_aci | 95.59 | |
| PF05876 | 557 | Terminase_GpA: Phage terminase large subunit (GpA) | 95.54 | |
| COG4332 | 203 | Uncharacterized protein conserved in bacteria [Fun | 95.47 | |
| PRK14973 | 936 | DNA topoisomerase I; Provisional | 95.43 | |
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 95.24 | |
| TIGR02098 | 38 | MJ0042_CXXC MJ0042 family finger-like domain. This | 95.24 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 95.23 | |
| PF11781 | 36 | RRN7: RNA polymerase I-specific transcription init | 95.19 | |
| COG2888 | 61 | Predicted Zn-ribbon RNA-binding protein with a fun | 95.12 | |
| PF07754 | 24 | DUF1610: Domain of unknown function (DUF1610); Int | 94.94 | |
| PF13453 | 41 | zf-TFIIB: Transcription factor zinc-finger | 94.93 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 94.87 | |
| PF01396 | 39 | zf-C4_Topoisom: Topoisomerase DNA binding C4 zinc | 94.8 | |
| PRK14890 | 59 | putative Zn-ribbon RNA-binding protein; Provisiona | 94.61 | |
| PF08271 | 43 | TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 | 94.6 | |
| TIGR03655 | 53 | anti_R_Lar restriction alleviation protein, Lar fa | 94.54 | |
| PF08274 | 30 | PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 | 94.53 | |
| cd00729 | 34 | rubredoxin_SM Rubredoxin, Small Modular nonheme ir | 94.49 | |
| PRK04023 | 1121 | DNA polymerase II large subunit; Validated | 94.43 | |
| PF01396 | 39 | zf-C4_Topoisom: Topoisomerase DNA binding C4 zinc | 94.38 | |
| PRK00398 | 46 | rpoP DNA-directed RNA polymerase subunit P; Provis | 94.31 | |
| PRK07220 | 740 | DNA topoisomerase I; Validated | 94.29 | |
| PF03811 | 36 | Zn_Tnp_IS1: InsA N-terminal domain; InterPro: IPR0 | 94.21 | |
| COG3478 | 68 | Predicted nucleic-acid-binding protein containing | 94.17 | |
| COG1779 | 201 | C4-type Zn-finger protein [General function predic | 94.06 | |
| PF13719 | 37 | zinc_ribbon_5: zinc-ribbon domain | 93.99 | |
| smart00709 | 160 | Zpr1 Duplicated domain in the epidermal growth fac | 93.79 | |
| TIGR02098 | 38 | MJ0042_CXXC MJ0042 family finger-like domain. This | 93.7 | |
| cd00730 | 50 | rubredoxin Rubredoxin; nonheme iron binding domain | 93.4 | |
| COG1645 | 131 | Uncharacterized Zn-finger containing protein [Gene | 93.39 | |
| TIGR02300 | 129 | FYDLN_acid conserved hypothetical protein TIGR0230 | 93.38 | |
| PF00301 | 47 | Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubred | 93.37 | |
| PRK14714 | 1337 | DNA polymerase II large subunit; Provisional | 93.34 | |
| TIGR00244 | 147 | transcriptional regulator NrdR. Members of this al | 93.09 | |
| PRK00241 | 256 | nudC NADH pyrophosphatase; Reviewed | 92.98 | |
| PF07282 | 69 | OrfB_Zn_ribbon: Putative transposase DNA-binding d | 92.94 | |
| PF09855 | 64 | DUF2082: Nucleic-acid-binding protein containing Z | 92.89 | |
| PF10058 | 54 | DUF2296: Predicted integral membrane metal-binding | 92.83 | |
| PF09526 | 71 | DUF2387: Probable metal-binding protein (DUF2387); | 92.71 | |
| PF03367 | 161 | zf-ZPR1: ZPR1 zinc-finger domain; InterPro: IPR004 | 92.49 | |
| cd00350 | 33 | rubredoxin_like Rubredoxin_like; nonheme iron bind | 92.39 | |
| PF03119 | 28 | DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc f | 92.37 | |
| COG2816 | 279 | NPY1 NTP pyrophosphohydrolases containing a Zn-fin | 92.35 | |
| COG2051 | 67 | RPS27A Ribosomal protein S27E [Translation, riboso | 92.34 | |
| PRK14559 | 645 | putative protein serine/threonine phosphatase; Pro | 92.29 | |
| TIGR02443 | 59 | conserved hypothetical metal-binding protein. Memb | 92.29 | |
| PF14354 | 61 | Lar_restr_allev: Restriction alleviation protein L | 92.18 | |
| PF07282 | 69 | OrfB_Zn_ribbon: Putative transposase DNA-binding d | 92.12 | |
| COG1773 | 55 | Rubredoxin [Energy production and conversion] | 92.03 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 91.97 | |
| PRK07219 | 822 | DNA topoisomerase I; Validated | 91.93 | |
| PF03604 | 32 | DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa | 91.79 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 91.78 | |
| PF09723 | 42 | Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 | 91.77 | |
| TIGR00310 | 192 | ZPR1_znf ZPR1 zinc finger domain. | 91.76 | |
| KOG3507 | 62 | consensus DNA-directed RNA polymerase, subunit RPB | 91.69 | |
| PF04032 | 85 | Rpr2: RNAse P Rpr2/Rpp21/SNM1 subunit domain; Inte | 91.5 | |
| TIGR01053 | 31 | LSD1 zinc finger domain, LSD1 subclass. This model | 91.28 | |
| smart00659 | 44 | RPOLCX RNA polymerase subunit CX. present in RNA p | 91.15 | |
| TIGR01206 | 54 | lysW lysine biosynthesis protein LysW. This very s | 91.07 | |
| PF06677 | 41 | Auto_anti-p27: Sjogren's syndrome/scleroderma auto | 91.07 | |
| COG2023 | 105 | RPR2 RNase P subunit RPR2 [Translation, ribosomal | 90.74 | |
| COG1592 | 166 | Rubrerythrin [Energy production and conversion] | 90.62 | |
| PRK00420 | 112 | hypothetical protein; Validated | 90.59 | |
| PF08772 | 73 | NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon lik | 90.52 | |
| PF13717 | 36 | zinc_ribbon_4: zinc-ribbon domain | 90.48 | |
| TIGR00686 | 109 | phnA alkylphosphonate utilization operon protein P | 90.3 | |
| PRK10220 | 111 | hypothetical protein; Provisional | 90.26 | |
| PF14353 | 128 | CpXC: CpXC protein | 90.21 | |
| PF11792 | 43 | Baculo_LEF5_C: Baculoviridae late expression facto | 90.03 | |
| PF01873 | 125 | eIF-5_eIF-2B: Domain found in IF2B/IF5; InterPro: | 89.97 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 89.93 | |
| COG1997 | 89 | RPL43A Ribosomal protein L37AE/L43A [Translation, | 89.77 | |
| COG0551 | 140 | TopA Zn-finger domain associated with topoisomeras | 89.59 | |
| PF09082 | 68 | DUF1922: Domain of unknown function (DUF1922); Int | 89.53 | |
| PF14311 | 55 | DUF4379: Domain of unknown function (DUF4379) | 89.52 | |
| COG1327 | 156 | Predicted transcriptional regulator, consists of a | 89.44 | |
| COG1997 | 89 | RPL43A Ribosomal protein L37AE/L43A [Translation, | 89.18 | |
| PHA02942 | 383 | putative transposase; Provisional | 89.09 | |
| COG1326 | 201 | Uncharacterized archaeal Zn-finger protein [Genera | 89.09 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 89.06 | |
| TIGR00311 | 133 | aIF-2beta translation initiation factor aIF-2, bet | 88.67 | |
| PF06044 | 254 | DRP: Dam-replacing family; InterPro: IPR010324 Dam | 88.4 | |
| PRK11827 | 60 | hypothetical protein; Provisional | 88.33 | |
| PRK11032 | 160 | hypothetical protein; Provisional | 88.02 | |
| PF07295 | 146 | DUF1451: Protein of unknown function (DUF1451); In | 87.96 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 87.83 | |
| PRK03988 | 138 | translation initiation factor IF-2 subunit beta; V | 87.83 | |
| PRK12286 | 57 | rpmF 50S ribosomal protein L32; Reviewed | 87.76 | |
| PRK06319 | 860 | DNA topoisomerase I/SWI domain fusion protein; Val | 87.73 | |
| PF13408 | 58 | Zn_ribbon_recom: Recombinase zinc beta ribbon doma | 87.58 | |
| PRK09678 | 72 | DNA-binding transcriptional regulator; Provisional | 87.58 | |
| PF08792 | 33 | A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I | 87.36 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 87.14 | |
| COG2888 | 61 | Predicted Zn-ribbon RNA-binding protein with a fun | 86.92 | |
| PF14205 | 55 | Cys_rich_KTR: Cysteine-rich KTR | 86.88 | |
| COG0777 | 294 | AccD Acetyl-CoA carboxylase beta subunit [Lipid me | 86.84 | |
| PRK00415 | 59 | rps27e 30S ribosomal protein S27e; Reviewed | 86.84 | |
| smart00531 | 147 | TFIIE Transcription initiation factor IIE. | 86.78 | |
| smart00647 | 64 | IBR In Between Ring fingers. the domains occurs be | 86.77 | |
| COG2835 | 60 | Uncharacterized conserved protein [Function unknow | 86.71 | |
| TIGR00515 | 285 | accD acetyl-CoA carboxylase, carboxyl transferase, | 86.65 | |
| PRK03824 | 135 | hypA hydrogenase nickel incorporation protein; Pro | 86.48 | |
| PRK14892 | 99 | putative transcription elongation factor Elf1; Pro | 86.43 | |
| PF10122 | 51 | Mu-like_Com: Mu-like prophage protein Com; InterPr | 86.37 | |
| PF06943 | 25 | zf-LSD1: LSD1 zinc finger; InterPro: IPR005735 Zin | 86.33 | |
| PF09526 | 71 | DUF2387: Probable metal-binding protein (DUF2387); | 86.23 | |
| CHL00174 | 296 | accD acetyl-CoA carboxylase beta subunit; Reviewed | 86.17 | |
| PF04216 | 290 | FdhE: Protein involved in formate dehydrogenase fo | 85.97 | |
| COG4640 | 465 | Predicted membrane protein [Function unknown] | 85.86 | |
| PF05129 | 81 | Elf1: Transcription elongation factor Elf1 like; I | 85.78 | |
| PF09151 | 36 | DUF1936: Domain of unknown function (DUF1936); Int | 85.5 | |
| PF01780 | 90 | Ribosomal_L37ae: Ribosomal L37ae protein family; I | 85.19 | |
| KOG3084 | 345 | consensus NADH pyrophosphatase I of the Nudix fami | 85.18 | |
| PRK05654 | 292 | acetyl-CoA carboxylase subunit beta; Validated | 84.83 | |
| PF02591 | 56 | DUF164: Putative zinc ribbon domain; InterPro: IPR | 84.61 | |
| smart00653 | 110 | eIF2B_5 domain present in translation initiation f | 84.57 | |
| PF01485 | 64 | IBR: IBR domain; InterPro: IPR002867 Zinc finger ( | 84.54 | |
| PRK09710 | 64 | lar restriction alleviation and modification prote | 84.48 | |
| COG1571 | 421 | Predicted DNA-binding protein containing a Zn-ribb | 84.4 | |
| PRK12336 | 201 | translation initiation factor IF-2 subunit beta; P | 83.9 | |
| PHA02942 | 383 | putative transposase; Provisional | 83.7 | |
| TIGR03826 | 137 | YvyF flagellar operon protein TIGR03826. This gene | 83.65 | |
| COG1779 | 201 | C4-type Zn-finger protein [General function predic | 83.49 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 83.42 | |
| PF03966 | 68 | Trm112p: Trm112p-like protein; InterPro: IPR005651 | 83.41 | |
| COG1571 | 421 | Predicted DNA-binding protein containing a Zn-ribb | 83.38 | |
| KOG2767 | 400 | consensus Translation initiation factor 5 (eIF-5) | 83.32 | |
| PF01921 | 360 | tRNA-synt_1f: tRNA synthetases class I (K); InterP | 82.79 | |
| PRK09521 | 189 | exosome complex RNA-binding protein Csl4; Provisio | 82.36 | |
| PRK05452 | 479 | anaerobic nitric oxide reductase flavorubredoxin; | 82.32 | |
| TIGR01031 | 55 | rpmF_bact ribosomal protein L32. This protein desc | 82.28 | |
| PF01783 | 56 | Ribosomal_L32p: Ribosomal L32p protein family; Int | 82.03 | |
| KOG0696 | 683 | consensus Serine/threonine protein kinase [Signal | 82.01 | |
| cd00674 | 353 | LysRS_core_class_I catalytic core domain of class | 81.73 | |
| PRK14890 | 59 | putative Zn-ribbon RNA-binding protein; Provisiona | 81.59 | |
| COG0675 | 364 | Transposase and inactivated derivatives [DNA repli | 81.45 | |
| PF01599 | 47 | Ribosomal_S27: Ribosomal protein S27a; InterPro: I | 81.11 | |
| PF01927 | 147 | Mut7-C: Mut7-C RNAse domain; InterPro: IPR002782 T | 80.88 | |
| PRK00423 | 310 | tfb transcription initiation factor IIB; Reviewed | 80.64 | |
| KOG0006 | 446 | consensus E3 ubiquitin-protein ligase (Parkin prot | 80.56 | |
| COG4530 | 129 | Uncharacterized protein conserved in bacteria [Fun | 80.12 |
| >KOG2906 consensus RNA polymerase III subunit C11 [Transcription] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-41 Score=218.15 Aligned_cols=101 Identities=34% Similarity=0.633 Sum_probs=83.6
Q ss_pred cccCccCCCcccccCCc----EEeCCCCCeeeccccccceEEEeeehhHHhhhhccccccccCCCccccccccccccccc
Q 040426 9 FLFCKFCGTMLRMESNH----VVCSSCKFKKNVQDVADREISYAVTAEEIKRELGISLFEQPQGDKGETQLSKVKRACEK 84 (120)
Q Consensus 9 ~~FCp~CgnlL~~~~~~----~~C~~C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~t~~~~~~~Cpk 84 (120)
|.|||.|||||.++++. |.|++|+|..+++. +|..++. +..+.+++ ++.+...+++...+++.||+
T Consensus 1 m~FCP~Cgn~Live~g~~~~rf~C~tCpY~~~I~~----ei~~r~~----~~~Kevd~--vlgg~~a~~nv~~t~~~Cp~ 70 (105)
T KOG2906|consen 1 MLFCPTCGNMLIVESGESCNRFSCRTCPYVFPISR----EISSRKY----PKLKEVDD--VLGGDEAWENVDQTEATCPT 70 (105)
T ss_pred CcccCCCCCEEEEecCCeEeeEEcCCCCceeeEee----eeecccc----Cchhhhhh--hcCCcccccchhhccCcCCC
Confidence 68999999999999764 99999999999975 3332221 22222233 56666678888999999999
Q ss_pred cCCCceEEEEeecccCCCCceEEEEcCCCCceecc
Q 040426 85 CQNPEMYYSTRQTRSADEGQTTYYICPRCGHRCQE 119 (120)
Q Consensus 85 Cg~~ea~y~~~Q~RSADE~~T~fY~C~~C~~~w~~ 119 (120)
|||++|+|+|+|+||||||||+||+|.+|+|+||+
T Consensus 71 Cgh~rayF~qlQtRSADEPmT~FYkC~~C~~~Wre 105 (105)
T KOG2906|consen 71 CGHERAYFMQLQTRSADEPMTTFYKCCKCKHRWRE 105 (105)
T ss_pred CCCCceEEEEeeeccCCCcHhHhhhhhcccccccC
Confidence 99999999999999999999999999999999996
|
|
| >COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] | Back alignment and domain information |
|---|
| >KOG2691 consensus RNA polymerase II subunit 9 [Transcription] | Back alignment and domain information |
|---|
| >TIGR01384 TFS_arch transcription factor S, archaeal | Back alignment and domain information |
|---|
| >KOG2907 consensus RNA polymerase I transcription factor TFIIS, subunit A12 | Back alignment and domain information |
|---|
| >smart00440 ZnF_C2C2 C2C2 Zinc finger | Back alignment and domain information |
|---|
| >PF01096 TFIIS_C: Transcription factor S-II (TFIIS); InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02998 RNA polymerase subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01385 TFSII transcription elongation factor S-II | Back alignment and domain information |
|---|
| >PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 | Back alignment and domain information |
|---|
| >KOG1105 consensus Transcription elongation factor TFIIS/Cofactor of enhancer-binding protein Sp1 [Transcription] | Back alignment and domain information |
|---|
| >smart00661 RPOL9 RNA polymerase subunit 9 | Back alignment and domain information |
|---|
| >PRK00432 30S ribosomal protein S27ae; Validated | Back alignment and domain information |
|---|
| >COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C | Back alignment and domain information |
|---|
| >PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] | Back alignment and domain information |
|---|
| >PF04606 Ogr_Delta: Ogr/Delta-like zinc finger; InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr | Back alignment and domain information |
|---|
| >PRK03564 formate dehydrogenase accessory protein FdhE; Provisional | Back alignment and domain information |
|---|
| >PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues | Back alignment and domain information |
|---|
| >PHA00626 hypothetical protein | Back alignment and domain information |
|---|
| >PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains | Back alignment and domain information |
|---|
| >PRK09678 DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF09855 DUF2082: Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082); InterPro: IPR018652 This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins | Back alignment and domain information |
|---|
| >TIGR01562 FdhE formate dehydrogenase accessory protein FdhE | Back alignment and domain information |
|---|
| >smart00661 RPOL9 RNA polymerase subunit 9 | Back alignment and domain information |
|---|
| >PHA00626 hypothetical protein | Back alignment and domain information |
|---|
| >PF13717 zinc_ribbon_4: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
| >PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc | Back alignment and domain information |
|---|
| >PRK00464 nrdR transcriptional regulator NrdR; Validated | Back alignment and domain information |
|---|
| >COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14353 CpXC: CpXC protein | Back alignment and domain information |
|---|
| >PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues | Back alignment and domain information |
|---|
| >PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA | Back alignment and domain information |
|---|
| >COG4332 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK14973 DNA topoisomerase I; Provisional | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] | Back alignment and domain information |
|---|
| >COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species | Back alignment and domain information |
|---|
| >PF13453 zf-TFIIB: Transcription factor zinc-finger | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >PF01396 zf-C4_Topoisom: Topoisomerase DNA binding C4 zinc finger; InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i | Back alignment and domain information |
|---|
| >PRK14890 putative Zn-ribbon RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR03655 anti_R_Lar restriction alleviation protein, Lar family | Back alignment and domain information |
|---|
| >PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues | Back alignment and domain information |
|---|
| >cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase | Back alignment and domain information |
|---|
| >PRK04023 DNA polymerase II large subunit; Validated | Back alignment and domain information |
|---|
| >PF01396 zf-C4_Topoisom: Topoisomerase DNA binding C4 zinc finger; InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i | Back alignment and domain information |
|---|
| >PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional | Back alignment and domain information |
|---|
| >PRK07220 DNA topoisomerase I; Validated | Back alignment and domain information |
|---|
| >PF03811 Zn_Tnp_IS1: InsA N-terminal domain; InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases | Back alignment and domain information |
|---|
| >COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG1779 C4-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13719 zinc_ribbon_5: zinc-ribbon domain | Back alignment and domain information |
|---|
| >smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1 | Back alignment and domain information |
|---|
| >TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain | Back alignment and domain information |
|---|
| >cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center | Back alignment and domain information |
|---|
| >COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 | Back alignment and domain information |
|---|
| >PF00301 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier [] | Back alignment and domain information |
|---|
| >PRK14714 DNA polymerase II large subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00244 transcriptional regulator NrdR | Back alignment and domain information |
|---|
| >PRK00241 nudC NADH pyrophosphatase; Reviewed | Back alignment and domain information |
|---|
| >PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins | Back alignment and domain information |
|---|
| >PF09855 DUF2082: Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082); InterPro: IPR018652 This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins | Back alignment and domain information |
|---|
| >PF10058 DUF2296: Predicted integral membrane metal-binding protein (DUF2296); InterPro: IPR019273 This domain, found mainly in the eukaryotic lunapark proteins, has no known function [] | Back alignment and domain information |
|---|
| >PF09526 DUF2387: Probable metal-binding protein (DUF2387); InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC | Back alignment and domain information |
|---|
| >PF03367 zf-ZPR1: ZPR1 zinc-finger domain; InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center | Back alignment and domain information |
|---|
| >PF03119 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc finger domain; InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14559 putative protein serine/threonine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02443 conserved hypothetical metal-binding protein | Back alignment and domain information |
|---|
| >PF14354 Lar_restr_allev: Restriction alleviation protein Lar | Back alignment and domain information |
|---|
| >PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins | Back alignment and domain information |
|---|
| >COG1773 Rubredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK07219 DNA topoisomerase I; Validated | Back alignment and domain information |
|---|
| >PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria | Back alignment and domain information |
|---|
| >TIGR00310 ZPR1_znf ZPR1 zinc finger domain | Back alignment and domain information |
|---|
| >KOG3507 consensus DNA-directed RNA polymerase, subunit RPB7 | Back alignment and domain information |
|---|
| >PF04032 Rpr2: RNAse P Rpr2/Rpp21/SNM1 subunit domain; InterPro: IPR007175 This family contains a ribonuclease P subunit of human and yeast | Back alignment and domain information |
|---|
| >TIGR01053 LSD1 zinc finger domain, LSD1 subclass | Back alignment and domain information |
|---|
| >smart00659 RPOLCX RNA polymerase subunit CX | Back alignment and domain information |
|---|
| >TIGR01206 lysW lysine biosynthesis protein LysW | Back alignment and domain information |
|---|
| >PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) | Back alignment and domain information |
|---|
| >COG2023 RPR2 RNase P subunit RPR2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1592 Rubrerythrin [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK00420 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF08772 NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon like; InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1 | Back alignment and domain information |
|---|
| >PF13717 zinc_ribbon_4: zinc-ribbon domain | Back alignment and domain information |
|---|
| >TIGR00686 phnA alkylphosphonate utilization operon protein PhnA | Back alignment and domain information |
|---|
| >PRK10220 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14353 CpXC: CpXC protein | Back alignment and domain information |
|---|
| >PF11792 Baculo_LEF5_C: Baculoviridae late expression factor 5 C-terminal domain; InterPro: IPR021758 This C-terminal domain is likely to be a zinc-binding domain | Back alignment and domain information |
|---|
| >PF01873 eIF-5_eIF-2B: Domain found in IF2B/IF5; InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology [] | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0551 TopA Zn-finger domain associated with topoisomerase type I [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF09082 DUF1922: Domain of unknown function (DUF1922); InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus | Back alignment and domain information |
|---|
| >PF14311 DUF4379: Domain of unknown function (DUF4379) | Back alignment and domain information |
|---|
| >COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription] | Back alignment and domain information |
|---|
| >COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PHA02942 putative transposase; Provisional | Back alignment and domain information |
|---|
| >COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative | Back alignment and domain information |
|---|
| >PF06044 DRP: Dam-replacing family; InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements | Back alignment and domain information |
|---|
| >PRK11827 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11032 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF07295 DUF1451: Protein of unknown function (DUF1451); InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >PRK03988 translation initiation factor IF-2 subunit beta; Validated | Back alignment and domain information |
|---|
| >PRK12286 rpmF 50S ribosomal protein L32; Reviewed | Back alignment and domain information |
|---|
| >PRK06319 DNA topoisomerase I/SWI domain fusion protein; Validated | Back alignment and domain information |
|---|
| >PF13408 Zn_ribbon_recom: Recombinase zinc beta ribbon domain | Back alignment and domain information |
|---|
| >PRK09678 DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF14205 Cys_rich_KTR: Cysteine-rich KTR | Back alignment and domain information |
|---|
| >COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK00415 rps27e 30S ribosomal protein S27e; Reviewed | Back alignment and domain information |
|---|
| >smart00531 TFIIE Transcription initiation factor IIE | Back alignment and domain information |
|---|
| >smart00647 IBR In Between Ring fingers | Back alignment and domain information |
|---|
| >COG2835 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit | Back alignment and domain information |
|---|
| >PRK03824 hypA hydrogenase nickel incorporation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14892 putative transcription elongation factor Elf1; Provisional | Back alignment and domain information |
|---|
| >PF10122 Mu-like_Com: Mu-like prophage protein Com; InterPro: IPR019294 Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ] | Back alignment and domain information |
|---|
| >PF06943 zf-LSD1: LSD1 zinc finger; InterPro: IPR005735 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF09526 DUF2387: Probable metal-binding protein (DUF2387); InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC | Back alignment and domain information |
|---|
| >CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed | Back alignment and domain information |
|---|
| >PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] | Back alignment and domain information |
|---|
| >COG4640 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05129 Elf1: Transcription elongation factor Elf1 like; InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines | Back alignment and domain information |
|---|
| >PF09151 DUF1936: Domain of unknown function (DUF1936); InterPro: IPR015234 This domain is found in a set of hypothetical archaeal proteins | Back alignment and domain information |
|---|
| >PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK05654 acetyl-CoA carboxylase subunit beta; Validated | Back alignment and domain information |
|---|
| >PF02591 DUF164: Putative zinc ribbon domain; InterPro: IPR003743 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5 | Back alignment and domain information |
|---|
| >PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PRK09710 lar restriction alleviation and modification protein; Reviewed | Back alignment and domain information |
|---|
| >COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12336 translation initiation factor IF-2 subunit beta; Provisional | Back alignment and domain information |
|---|
| >PHA02942 putative transposase; Provisional | Back alignment and domain information |
|---|
| >TIGR03826 YvyF flagellar operon protein TIGR03826 | Back alignment and domain information |
|---|
| >COG1779 C4-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >PF03966 Trm112p: Trm112p-like protein; InterPro: IPR005651 This family of short proteins have no known function | Back alignment and domain information |
|---|
| >COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2767 consensus Translation initiation factor 5 (eIF-5) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01921 tRNA-synt_1f: tRNA synthetases class I (K); InterPro: IPR002904 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PRK09521 exosome complex RNA-binding protein Csl4; Provisional | Back alignment and domain information |
|---|
| >PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR01031 rpmF_bact ribosomal protein L32 | Back alignment and domain information |
|---|
| >PF01783 Ribosomal_L32p: Ribosomal L32p protein family; InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00674 LysRS_core_class_I catalytic core domain of class I lysyl tRNA synthetase | Back alignment and domain information |
|---|
| >PRK14890 putative Zn-ribbon RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF01599 Ribosomal_S27: Ribosomal protein S27a; InterPro: IPR002906 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PF01927 Mut7-C: Mut7-C RNAse domain; InterPro: IPR002782 This prokaryotic family of proteins have no known function | Back alignment and domain information |
|---|
| >PRK00423 tfb transcription initiation factor IIB; Reviewed | Back alignment and domain information |
|---|
| >KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4530 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 120 | ||||
| 3qt1_I | 133 | Rna Polymerase Ii Variant Containing A Chimeric Rpb | 1e-06 | ||
| 1qyp_A | 57 | Thermococcus Celer Rpb9, Nmr, 25 Structures Length | 2e-04 |
| >pdb|3QT1|I Chain I, Rna Polymerase Ii Variant Containing A Chimeric Rpb9-C11 Subunit Length = 133 | Back alignment and structure |
|
| >pdb|1QYP|A Chain A, Thermococcus Celer Rpb9, Nmr, 25 Structures Length = 57 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 120 | |||
| 3h0g_I | 113 | DNA-directed RNA polymerases I, II, and III subuni | 6e-16 | |
| 3qt1_I | 133 | DNA-directed RNA polymerases I, II, and III subun; | 5e-15 | |
| 1qyp_A | 57 | RNA polymerase II; transcription, RPB9, Zn ribbon, | 1e-12 | |
| 1twf_I | 122 | B12.6, DNA-directed RNA polymerase II 14.2 kDa pol | 2e-12 | |
| 3po3_S | 178 | Transcription elongation factor S-II; RNA polymera | 1e-10 | |
| 1tfi_A | 50 | Transcriptional elongation factor SII; transcripti | 3e-10 | |
| 1pqv_S | 309 | STP-alpha, transcription elongation factor S-II, D | 2e-09 |
| >3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 113 | Back alignment and structure |
|---|
Score = 67.1 bits (163), Expect = 6e-16
Identities = 20/115 (17%), Positives = 34/115 (29%), Gaps = 14/115 (12%)
Query: 8 DFLFCKFCGTMLRMESNHV------VCSSCKFKKNVQDVADREISYAVTAEEIKRELGIS 61
+F +C C ML + V C +C + + + E
Sbjct: 3 NFQYCIECNNMLYPREDKVDRVLRLACRNCDYSEIAATSKVYRHELQSSNVENTTVS--- 59
Query: 62 LFEQPQGDKGETQLSKVKRACEKCQNPEMYYSTRQTRSADEGQTTYYICPRCGHR 116
+ L + + C +C E + +R D T Y+C CG
Sbjct: 60 -----HDASTDPTLPRSDKECPRCHQHEAVFYQTHSRRGDTMMTLIYVCVHCGFA 109
|
| >3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} Length = 133 | Back alignment and structure |
|---|
| >1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1 Length = 57 | Back alignment and structure |
|---|
| >1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... Length = 122 | Back alignment and structure |
|---|
| >3po3_S Transcription elongation factor S-II; RNA polymerase II, mRNA, transcription, arrest, BACKTRACKING cleavage, transferase-DNA-RNA complex; HET: DNA BRU EPE PGE; 3.30A {Saccharomyces cerevisiae} PDB: 1y1v_S 1y1y_S 3gtm_S* 1enw_A Length = 178 | Back alignment and structure |
|---|
| >1tfi_A Transcriptional elongation factor SII; transcription regulation; NMR {Homo sapiens} SCOP: g.41.3.1 Length = 50 | Back alignment and structure |
|---|
| >1pqv_S STP-alpha, transcription elongation factor S-II, DNA; mRNA cleavage, proofreading, BACKTRACKING, gene expression, multiprotein complex; 3.80A {Saccharomyces cerevisiae} SCOP: i.8.1.1 PDB: 1eo0_A Length = 309 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 120 | |||
| 1twf_I | 122 | B12.6, DNA-directed RNA polymerase II 14.2 kDa pol | 100.0 | |
| 3h0g_I | 113 | DNA-directed RNA polymerases I, II, and III subuni | 100.0 | |
| 3qt1_I | 133 | DNA-directed RNA polymerases I, II, and III subun; | 100.0 | |
| 1qyp_A | 57 | RNA polymerase II; transcription, RPB9, Zn ribbon, | 99.93 | |
| 1tfi_A | 50 | Transcriptional elongation factor SII; transcripti | 99.93 | |
| 3po3_S | 178 | Transcription elongation factor S-II; RNA polymera | 99.82 | |
| 1pqv_S | 309 | STP-alpha, transcription elongation factor S-II, D | 99.76 | |
| 2k4x_A | 55 | 30S ribosomal protein S27AE; metal-binding, ribonu | 98.05 | |
| 3j20_Y | 50 | 30S ribosomal protein S27AE; archaea, archaeal, KI | 97.67 | |
| 2fiy_A | 309 | Protein FDHE homolog; FDHE protein, structural gen | 97.45 | |
| 1k81_A | 36 | EIF-2-beta, probable translation initiation factor | 96.27 | |
| 6rxn_A | 46 | Rubredoxin; electron transfer(iron-sulfur protein) | 95.47 | |
| 2akl_A | 138 | PHNA-like protein PA0128; two domains, Zn binding | 95.11 | |
| 1gh9_A | 71 | 8.3 kDa protein (gene MTH1184); beta+alpha complex | 95.06 | |
| 1yk4_A | 52 | Rubredoxin, RD; electron transport; 0.69A {Pyrococ | 94.45 | |
| 2jr6_A | 68 | UPF0434 protein NMA0874; solution, structural geno | 94.36 | |
| 3a43_A | 139 | HYPD, hydrogenase nickel incorporation protein HYP | 94.33 | |
| 2js4_A | 70 | UPF0434 protein BB2007; NESG, northeast structural | 94.29 | |
| 2v3b_B | 55 | Rubredoxin 2, rubredoxin; alkane degradation, iron | 94.25 | |
| 1pft_A | 50 | TFIIB, PFTFIIBN; N-terminal domain, transcription | 94.23 | |
| 4rxn_A | 54 | Rubredoxin; electron transfer(iron-sulfur protein) | 94.21 | |
| 2kn9_A | 81 | Rubredoxin; metalloprotein, ssgcid, structural gen | 94.13 | |
| 1dl6_A | 58 | Transcription factor II B (TFIIB); zinc ribbon, ge | 93.96 | |
| 1e8j_A | 52 | Rubredoxin; iron-sulfur-protein, zinc-substitution | 93.84 | |
| 2pk7_A | 69 | Uncharacterized protein; NESG, PLR1, putative tetr | 93.78 | |
| 2hf1_A | 68 | Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A | 93.75 | |
| 2ct7_A | 86 | Ring finger protein 31; IBR, structural genomics, | 93.69 | |
| 1pft_A | 50 | TFIIB, PFTFIIBN; N-terminal domain, transcription | 93.54 | |
| 1dx8_A | 70 | Rubredoxin; electron transport, zinc-substitution; | 93.52 | |
| 2jny_A | 67 | Uncharacterized BCR; structure, CGR1, NESG, struct | 93.14 | |
| 2kdx_A | 119 | HYPA, hydrogenase/urease nickel incorporation prot | 93.12 | |
| 1s24_A | 87 | Rubredoxin 2; electron transport; NMR {Pseudomonas | 93.11 | |
| 2fnf_X | 72 | Putative RAS effector NORE1; zinc, signal transduc | 92.82 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 92.81 | |
| 3m7n_A | 179 | Putative uncharacterized protein AF_0206; exosome, | 92.57 | |
| 1lko_A | 191 | Rubrerythrin all-iron(II) form; reduced form, DIIR | 92.44 | |
| 1rfh_A | 59 | RAS association (ralgds/AF-6) domain family 5; zin | 92.07 | |
| 2kpi_A | 56 | Uncharacterized protein SCO3027; zinc finger, PSI- | 92.02 | |
| 1x0t_A | 120 | Ribonuclease P protein component 4; pyrococcus hor | 91.89 | |
| 2k3r_A | 123 | Ribonuclease P protein component 4; PFU RPP21, RNA | 91.49 | |
| 1vk6_A | 269 | NADH pyrophosphatase; 1790429, structural genomics | 91.25 | |
| 3pwf_A | 170 | Rubrerythrin; non heme iron peroxidases, oxidative | 91.25 | |
| 1vq8_Z | 83 | 50S ribosomal protein L37AE; ribosome 50S, protein | 91.19 | |
| 4esj_A | 257 | Type-2 restriction enzyme DPNI; restriction endonu | 91.18 | |
| 3h0g_I | 113 | DNA-directed RNA polymerases I, II, and III subuni | 90.86 | |
| 3j21_g | 51 | 50S ribosomal protein L40E; archaea, archaeal, KIN | 90.6 | |
| 1faq_A | 52 | RAF-1; transferase, serine/threonine-protein kinas | 90.46 | |
| 3qt1_I | 133 | DNA-directed RNA polymerases I, II, and III subun; | 90.45 | |
| 1twf_L | 70 | ABC10-alpha, DNA-directed RNA polymerases I, II, a | 90.19 | |
| 1yuz_A | 202 | Nigerythrin; rubrythrin, rubredoxin, hemerythrin, | 90.19 | |
| 1dl6_A | 58 | Transcription factor II B (TFIIB); zinc ribbon, ge | 89.7 | |
| 1vq8_Z | 83 | 50S ribosomal protein L37AE; ribosome 50S, protein | 89.68 | |
| 1ptq_A | 50 | Protein kinase C delta type; phosphotransferase; 1 | 89.66 | |
| 2con_A | 79 | RUH-035 protein, NIN one binding protein; ribosome | 89.45 | |
| 3h0g_L | 63 | DNA-directed RNA polymerases I, II, and III subuni | 88.75 | |
| 2g2k_A | 170 | EIF-5, eukaryotic translation initiation factor 5; | 88.35 | |
| 2enz_A | 65 | NPKC-theta, protein kinase C theta type; zinc bind | 87.52 | |
| 2akl_A | 138 | PHNA-like protein PA0128; two domains, Zn binding | 87.08 | |
| 3uej_A | 65 | NPKC-delta, protein kinase C delta type; proteine | 87.0 | |
| 2e9h_A | 157 | EIF-5, eukaryotic translation initiation factor 5; | 86.83 | |
| 3cc2_Z | 116 | 50S ribosomal protein L37AE, 50S ribosomal protein | 86.26 | |
| 1y8f_A | 66 | UNC-13 homolog A, MUNC13-1; cysteine-rich domain, | 86.06 | |
| 2yuu_A | 83 | NPKC-delta, protein kinase C delta type; metal bin | 85.73 | |
| 3ga8_A | 78 | HTH-type transcriptional regulator MQSA (YGIT/B30; | 84.45 | |
| 3iz5_m | 92 | 60S ribosomal protein L43 (L37AE); eukaryotic ribo | 84.23 | |
| 2eli_A | 85 | Protein kinase C alpha type; PKC-alpha, PKC-A, str | 84.13 | |
| 3j21_i | 83 | 50S ribosomal protein L37AE; archaea, archaeal, KI | 83.67 | |
| 2enn_A | 77 | NPKC-theta, protein kinase C theta type; zinc bind | 83.46 | |
| 2jne_A | 101 | Hypothetical protein YFGJ; zinc fingers, two zinc, | 83.21 | |
| 3k1f_M | 197 | Transcription initiation factor IIB; RNA polymeras | 83.09 | |
| 2qkd_A | 404 | Zinc finger protein ZPR1; helical hairpins, beta h | 82.51 | |
| 1nee_A | 138 | EIF-2-beta, probable translation initiation factor | 82.22 | |
| 2row_A | 84 | RHO-associated protein kinase 2; ATP-binding, coil | 81.47 | |
| 2d74_B | 148 | Translation initiation factor 2 beta subunit; prot | 81.01 | |
| 2fiy_A | 309 | Protein FDHE homolog; FDHE protein, structural gen | 80.64 | |
| 2jrp_A | 81 | Putative cytoplasmic protein; two-zinc binding pro | 80.58 | |
| 3jyw_9 | 72 | 60S ribosomal protein L43; eukaryotic ribosome, RA | 80.3 |
| >1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... | Back alignment and structure |
|---|
Probab=100.00 E-value=2.9e-42 Score=233.93 Aligned_cols=106 Identities=22% Similarity=0.502 Sum_probs=88.5
Q ss_pred CCcccCccCCCcccccCC----c--EEeCCCCCeeeccccccceEEEeeehhHHhhhhccccccccCCCccccccccccc
Q 040426 7 RDFLFCKFCGTMLRMESN----H--VVCSSCKFKKNVQDVADREISYAVTAEEIKRELGISLFEQPQGDKGETQLSKVKR 80 (120)
Q Consensus 7 ~~~~FCp~CgnlL~~~~~----~--~~C~~C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~t~~~~~~ 80 (120)
++|.|||+|||||+|+++ . |.|++|||.++++. .++|++... +..+++.. |+.++..|+++|+++.
T Consensus 2 ~~~~FCp~CgnlL~~~~~~~~~~~~~~C~~C~y~~~~~~----~~v~~~~~~---~~~~e~~~-v~~~~~~~~t~p~t~~ 73 (122)
T 1twf_I 2 TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGS----PLVYRHELI---TNIGETAG-VVQDIGSDPTLPRSDR 73 (122)
T ss_dssp CCCCBCSSSCCBCEEEEETTTTEEEEECSSSSCEEECSC----SEEEEEESS---CCTTSSTT-CCTTGGGCTTSCCCCC
T ss_pred CCCCcccccCccCcccccCcCCCCEEECCcCCCeeecCc----cEEEEEeec---cccccccc-ccccccccccccccCC
Confidence 579999999999999864 2 99999999999874 567766532 12333333 5566667899999999
Q ss_pred cccccCCCceEEEEeecccCCCCceEEEEcCCCCceeccC
Q 040426 81 ACEKCQNPEMYYSTRQTRSADEGQTTYYICPRCGHRCQES 120 (120)
Q Consensus 81 ~CpkCg~~ea~y~~~Q~RSADE~~T~fY~C~~C~~~w~~n 120 (120)
.||+|||++|+|||+|+||||||||+||+|++|||+|++|
T Consensus 74 ~Cp~C~~~~a~~~q~q~rsade~~t~fy~C~~C~~~w~~n 113 (122)
T 1twf_I 74 ECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSD 113 (122)
T ss_dssp CCTTTCCCCEEEEECSSCCTTCCCCEEEEETTTCCEEECC
T ss_pred CCCCCCCCEEEEEEecCccCCCCceEEEEeCCCCCEeccC
Confidence 9999999999999999999999999999999999999986
|
| >3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >1tfi_A Transcriptional elongation factor SII; transcription regulation; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >3po3_S Transcription elongation factor S-II; RNA polymerase II, mRNA, transcription, arrest, BACKTRACKING cleavage, transferase-DNA-RNA complex; HET: DNA BRU EPE PGE; 3.30A {Saccharomyces cerevisiae} PDB: 1y1v_S 1y1y_S 3gtm_S* 1enw_A | Back alignment and structure |
|---|
| >1pqv_S STP-alpha, transcription elongation factor S-II, DNA; mRNA cleavage, proofreading, BACKTRACKING, gene expression, multiprotein complex; 3.80A {Saccharomyces cerevisiae} SCOP: i.8.1.1 PDB: 1eo0_A | Back alignment and structure |
|---|
| >2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 | Back alignment and structure |
|---|
| >3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 | Back alignment and structure |
|---|
| >1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1 | Back alignment and structure |
|---|
| >6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 | Back alignment and structure |
|---|
| >2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5 | Back alignment and structure |
|---|
| >1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 | Back alignment and structure |
|---|
| >1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... | Back alignment and structure |
|---|
| >2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* | Back alignment and structure |
|---|
| >2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... | Back alignment and structure |
|---|
| >2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A | Back alignment and structure |
|---|
| >1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A | Back alignment and structure |
|---|
| >2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1 | Back alignment and structure |
|---|
| >2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 | Back alignment and structure |
|---|
| >2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 | Back alignment and structure |
|---|
| >1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A | Back alignment and structure |
|---|
| >2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 | Back alignment and structure |
|---|
| >2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1s24_A Rubredoxin 2; electron transport; NMR {Pseudomonas oleovorans} SCOP: g.41.5.1 | Back alignment and structure |
|---|
| >2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} | Back alignment and structure |
|---|
| >3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A | Back alignment and structure |
|---|
| >1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A | Back alignment and structure |
|---|
| >1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1x0t_A Ribonuclease P protein component 4; pyrococcus horikoshii OT3, hydrolase; 1.60A {Pyrococcus horikoshii} PDB: 2zae_B | Back alignment and structure |
|---|
| >2k3r_A Ribonuclease P protein component 4; PFU RPP21, RNAse P, hydrolase, tRNA processing; NMR {Pyrococcus furiosus} PDB: 2ki7_B | Back alignment and structure |
|---|
| >1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A | Back alignment and structure |
|---|
| >3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A | Back alignment and structure |
|---|
| >1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... | Back alignment and structure |
|---|
| >4esj_A Type-2 restriction enzyme DPNI; restriction endonuclease-DNA complex, type IIM, type IIE, RE enzyme, DPNI; HET: DNA 6MA; 2.05A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3j21_g 50S ribosomal protein L40E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A | Back alignment and structure |
|---|
| >3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... | Back alignment and structure |
|---|
| >1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A | Back alignment and structure |
|---|
| >1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A | Back alignment and structure |
|---|
| >1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... | Back alignment and structure |
|---|
| >1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A* | Back alignment and structure |
|---|
| >2con_A RUH-035 protein, NIN one binding protein; ribosome, RNA binding protein, unknown function, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.15.1 | Back alignment and structure |
|---|
| >3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2g2k_A EIF-5, eukaryotic translation initiation factor 5; EIF125 fold; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5 | Back alignment and structure |
|---|
| >3uej_A NPKC-delta, protein kinase C delta type; proteine kinase cdelta, phosphotransferase, anesthetic bindi metal binding protein; 1.30A {Mus musculus} PDB: 3ugi_A 3ugl_A 3uey_A 3ugd_A 3uff_A 1ptq_A 1ptr_A* | Back alignment and structure |
|---|
| >2e9h_A EIF-5, eukaryotic translation initiation factor 5; zinc binding, C4 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z | Back alignment and structure |
|---|
| >1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ga8_A HTH-type transcriptional regulator MQSA (YGIT/B30; helix-turn-helix, Zn-binding protein, DNA-binding, transcrip transcription regulation; HET: PE4; 1.70A {Escherichia coli k-12} PDB: 3hi2_A | Back alignment and structure |
|---|
| >2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 | Back alignment and structure |
|---|
| >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qkd_A Zinc finger protein ZPR1; helical hairpins, beta helix, anti-parrallel beta sheet, double straded anti-parallel beta helix, metal binding protein; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1nee_A EIF-2-beta, probable translation initiation factor 2 beta subunit; two domain protein, mixed alpha-beta structure; NMR {Methanothermobacterthermautotrophicus} SCOP: d.241.1.1 g.59.1.1 | Back alignment and structure |
|---|
| >2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2d74_B Translation initiation factor 2 beta subunit; protein complex; 2.80A {Pyrococcus furiosus} PDB: 2dcu_B* | Back alignment and structure |
|---|
| >2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 | Back alignment and structure |
|---|
| >2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 120 | ||||
| d1qypa_ | 57 | g.41.3.1 (A:) RBP9 subunit of RNA polymerase II {A | 3e-12 | |
| d1tfia_ | 50 | g.41.3.1 (A:) Transcriptional factor SII, C-termin | 5e-11 | |
| d1twfi2 | 72 | g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase | 6e-11 |
| >d1qypa_ g.41.3.1 (A:) RBP9 subunit of RNA polymerase II {Archaeon Thermococcus celer [TaxId: 2264]} Length = 57 | Back information, alignment and structure |
|---|
class: Small proteins fold: Rubredoxin-like superfamily: Zinc beta-ribbon family: Transcriptional factor domain domain: RBP9 subunit of RNA polymerase II species: Archaeon Thermococcus celer [TaxId: 2264]
Score = 54.8 bits (132), Expect = 3e-12
Identities = 18/51 (35%), Positives = 25/51 (49%)
Query: 69 DKGETQLSKVKRACEKCQNPEMYYSTRQTRSADEGQTTYYICPRCGHRCQE 119
++ L K C KC N Y+ QTR+ DE T +Y C +CGH +
Sbjct: 5 EQDLKTLPTTKITCPKCGNDTAYWWEMQTRAGDEPSTIFYKCTKCGHTWRS 55
|
| >d1tfia_ g.41.3.1 (A:) Transcriptional factor SII, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 50 | Back information, alignment and structure |
|---|
| >d1twfi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 120 | |||
| d1twfi2 | 72 | RBP9 subunit of RNA polymerase II {Baker's yeast ( | 99.96 | |
| d1qypa_ | 57 | RBP9 subunit of RNA polymerase II {Archaeon Thermo | 99.95 | |
| d1tfia_ | 50 | Transcriptional factor SII, C-terminal domain {Hum | 99.9 | |
| d1twfi1 | 49 | RBP9 subunit of RNA polymerase II {Baker's yeast ( | 99.55 | |
| d2akla2 | 38 | Hypothetical protein PA0128, N-terminal domain {Ps | 96.76 | |
| d1lkoa2 | 44 | Rubrerythrin, C-terminal domain {Desulfovibrio vul | 96.61 | |
| d2fiya1 | 290 | FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId | 96.57 | |
| d1dx8a_ | 70 | Rubredoxin {Guillardia theta [TaxId: 55529]} | 96.51 | |
| d2akla2 | 38 | Hypothetical protein PA0128, N-terminal domain {Ps | 96.03 | |
| d2dsxa1 | 52 | Rubredoxin {Desulfovibrio gigas [TaxId: 879]} | 95.46 | |
| d1iroa_ | 53 | Rubredoxin {Clostridium pasteurianum [TaxId: 1501] | 95.36 | |
| d1brfa_ | 53 | Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2 | 95.17 | |
| d1yuza2 | 36 | Nigerythrin, C-terminal domain {Desulfovibrio vulg | 95.01 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 94.77 | |
| d6rxna_ | 45 | Rubredoxin {Desulfovibrio desulfuricans, strain 27 | 94.68 | |
| d2k4xa1 | 55 | Ribosomal protein S27ae {Thermoplasma acidophilum | 94.66 | |
| d1s24a_ | 56 | Two-iron rubredoxin {Pseudomonas oleovorans [TaxId | 94.62 | |
| d1nnqa2 | 37 | Rubrerythrin, C-terminal domain {Archaeon Pyrococc | 94.38 | |
| d2jnya1 | 59 | Uncharacterized protein Cgl1405/cg1592 {Corynebact | 94.23 | |
| d2hf1a1 | 59 | Hypothetical protein CV3345 {Chromobacterium viola | 92.56 | |
| d2cona1 | 66 | RNA-binding protein NOB1 (Nin one binding) {Mouse | 92.14 | |
| d1dl6a_ | 58 | Transcription initiation factor TFIIB, N-terminal | 92.04 | |
| d2pk7a1 | 59 | Uncharacterized protein PFL1779 {Pseudomonas fluor | 91.02 | |
| d1dl6a_ | 58 | Transcription initiation factor TFIIB, N-terminal | 90.5 | |
| d1twfl_ | 46 | RBP12 subunit of RNA polymerase II {Baker's yeast | 90.15 | |
| d1pfta_ | 50 | Transcription initiation factor TFIIB, N-terminal | 88.95 | |
| d2f9yb1 | 263 | Acetyl-coenzyme A carboxylase carboxyl transferase | 88.06 | |
| d2ayja1 | 56 | Ribosomal protein L40e {Sulfolobus solfataricus [T | 86.3 | |
| d1pfva3 | 35 | Methionyl-tRNA synthetase (MetRS), Zn-domain {Esch | 85.81 | |
| d1vqoz1 | 73 | Ribosomal protein L37ae {Archaeon Haloarcula maris | 85.16 | |
| d1ptqa_ | 50 | Protein kinase C-delta (PKCdelta) {Mouse (Mus musc | 84.71 | |
| d1tbna_ | 66 | Protein kinase c-gamma {Rat (Rattus rattus) [TaxId | 84.15 | |
| d2fiya1 | 290 | FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId | 84.04 | |
| d1x6ha1 | 37 | Transcriptional repressor CTCF {Human (Homo sapien | 83.57 | |
| d1pvma3 | 36 | Hypothetical protein Ta0289 C-terminal domain {Arc | 83.45 | |
| d1qxfa_ | 58 | Ribosomal protein S27e {Archaeon Archaeoglobus ful | 83.38 | |
| d1k3xa3 | 40 | Endonuclease VIII {Escherichia coli [TaxId: 562]} | 82.79 | |
| d2jnea1 | 71 | Hypothetical protein YfgJ {Escherichia coli [TaxId | 82.62 | |
| d1k81a_ | 36 | Zinc-binding domain of translation initiation fact | 82.37 | |
| d1rqga3 | 35 | Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyro | 82.16 | |
| d1jj2y_ | 73 | Ribosomal protein L37ae {Archaeon Haloarcula maris | 81.58 | |
| d1faqa_ | 52 | RAF-1 {Human (Homo sapiens) [TaxId: 9606]} | 81.46 | |
| d1vk6a4 | 29 | NADH pyrophosphatase intervening domain {Escherich | 80.64 |
| >d1twfi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Rubredoxin-like superfamily: Zinc beta-ribbon family: Transcriptional factor domain domain: RBP9 subunit of RNA polymerase II species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.96 E-value=2.1e-30 Score=158.64 Aligned_cols=57 Identities=23% Similarity=0.497 Sum_probs=54.3
Q ss_pred cccCCCccccccccccccccccCCCceEEEEeecccCCCCceEEEEcCCCCceeccC
Q 040426 64 EQPQGDKGETQLSKVKRACEKCQNPEMYYSTRQTRSADEGQTTYYICPRCGHRCQES 120 (120)
Q Consensus 64 ~i~~~~~~~~t~~~~~~~CpkCg~~ea~y~~~Q~RSADE~~T~fY~C~~C~~~w~~n 120 (120)
.|+.|+..||+||++++.||+|||++|+|||+|+||||||||+||+|++|||+||+|
T Consensus 8 ~v~~d~~~DPtlp~t~~~CpkCg~~~a~~~q~QtRsaDE~mT~Fy~C~~C~h~Wr~~ 64 (72)
T d1twfi2 8 GVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSD 64 (72)
T ss_dssp TCCTTGGGCTTSCCCCCCCTTTCCCCEEEEECSSCCTTCCCCEEEEETTTCCEEECC
T ss_pred ccccccccCCCCCccCCCCCCCCCCeEEEEEeecCccCCCceEEEEcCCCCCCcccc
Confidence 378888899999999999999999999999999999999999999999999999976
|
| >d1qypa_ g.41.3.1 (A:) RBP9 subunit of RNA polymerase II {Archaeon Thermococcus celer [TaxId: 2264]} | Back information, alignment and structure |
|---|
| >d1tfia_ g.41.3.1 (A:) Transcriptional factor SII, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1twfi1 g.41.3.1 (I:1-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1dx8a_ g.41.5.1 (A:) Rubredoxin {Guillardia theta [TaxId: 55529]} | Back information, alignment and structure |
|---|
| >d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1brfa_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]} | Back information, alignment and structure |
|---|
| >d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2jnya1 b.171.1.1 (A:1-59) Uncharacterized protein Cgl1405/cg1592 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d2hf1a1 b.171.1.1 (A:2-60) Hypothetical protein CV3345 {Chromobacterium violaceum [TaxId: 536]} | Back information, alignment and structure |
|---|
| >d2cona1 g.41.15.1 (A:8-73) RNA-binding protein NOB1 (Nin one binding) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pk7a1 b.171.1.1 (A:3-61) Uncharacterized protein PFL1779 {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1twfl_ g.41.9.2 (L:) RBP12 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ayja1 g.41.8.7 (A:1-56) Ribosomal protein L40e {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1pfva3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pvma3 g.41.13.1 (A:143-178) Hypothetical protein Ta0289 C-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1qxfa_ g.41.8.4 (A:) Ribosomal protein S27e {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1k3xa3 g.39.1.8 (A:223-262) Endonuclease VIII {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k81a_ g.59.1.1 (A:) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vk6a4 g.41.14.1 (A:97-125) NADH pyrophosphatase intervening domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|