Citrus Sinensis ID: 040431


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MASKSKILFIGGTGYIGKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLADQVKIIAAIKEAEGASRGTLRTQKGKMSSLSSEMTTTLDMLEMTELIDQKIFIYFWGRTLNTGRRYR
cccccEEEEEccccccHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHcccccEEEEcccccHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHHHHHHHcccEEEEcccccccccc
cccccEEEEEEcccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHccEEEEEccHHHHHHHHHHHHHHHHHccccccccccHHHHEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHcc
MASKSKILFIGGTGYIGKFTVEASVKAGHPTFVLVREstisgpsksqLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLADQVKIIAAIKEaegasrgtlrtqkgkmsslssemTTTLDMLEMTELIDQKIFIYFWgrtlntgrryr
MASKSKILFIGGTGYIGKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLADQVKIIAAIKeaegasrgtlrtqkgkmsslssEMTTTLDMLEMTELIDQKifiyfwgrtlntgrryr
MASKSKILFIGGTGYIGKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLADQVkiiaaikeaeGASRGTLRTQKGKmsslssemtttldmlemtelIDQKIFIYFWGRTLNTGRRYR
******ILFIGGTGYIGKFTVEASVKAGHPTFVLVRESTISG**KSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLADQVKIIAAIK***************************LDMLEMTELIDQKIFIYFWGRTLN******
**SKSKILFIGGTGYIGKFTVEASVKAGHPTFVLVREST******SQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLADQVKIIAAIKEAEGASRGTLRTQKGKMSSLSSEMTTTLDMLEMTELIDQKIFIYFWGRTLNT*****
MASKSKILFIGGTGYIGKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLADQVKIIAAIKEAEGA*****************EMTTTLDMLEMTELIDQKIFIYFWGRTLNTGRRYR
***KSKILFIGGTGYIGKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLADQVKIIAAIKEAEGASRGTLRTQKGKMSSLSSEMTTTLDMLEMTELIDQKIFIYFWGRTLNTGRR*R
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASKSKILFIGGTGYIGKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLADQVKIIAAIKEAEGASRGTLRTQKGKMSSLSSEMTTTLDMLEMTELIDQKIFIYFWGRTLNTGRRYR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query157 2.2.26 [Sep-21-2011]
P52578 308 Isoflavone reductase homo N/A no 0.681 0.347 0.766 4e-40
E1U332 308 Isoflavone reductase-like N/A no 0.681 0.347 0.700 2e-35
P52579 310 Isoflavone reductase homo N/A no 0.681 0.345 0.644 7e-33
P52577 310 Isoflavone reductase homo no no 0.662 0.335 0.673 2e-31
P52575 318 Isoflavone reductase OS=M N/A no 0.649 0.320 0.513 7e-24
Q00016 318 Isoflavone reductase OS=C N/A no 0.681 0.336 0.516 5e-23
P52580 309 Isoflavone reductase homo N/A no 0.681 0.346 0.509 8e-23
P52576 318 Isoflavone reductase OS=P N/A no 0.681 0.336 0.466 2e-21
Q15GI4 314 Eugenol synthase 1 OS=Oci N/A no 0.636 0.318 0.490 2e-19
Q15GI3 323 Isoeugenol synthase 1 OS= N/A no 0.662 0.321 0.457 6e-18
>sp|P52578|IFRH_SOLTU Isoflavone reductase homolog OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function desciption
 Score =  163 bits (412), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/107 (76%), Positives = 91/107 (85%)

Query: 1   MASKSKILFIGGTGYIGKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLV 60
           MA KSKILFIGGTGYIGKF VEAS KAGH TFVLVREST+S P+K++L+D FK+ GV  V
Sbjct: 1   MAGKSKILFIGGTGYIGKFIVEASAKAGHDTFVLVRESTLSNPTKTKLIDTFKSFGVTFV 60

Query: 61  IGDVLNHESLVKAIKQVDVVISTVGHTLLADQVKIIAAIKEAEGASR 107
            GD+ +HESLVKAIKQVDVVISTVGH LLADQVK+IAAIKEA    R
Sbjct: 61  HGDLYDHESLVKAIKQVDVVISTVGHALLADQVKLIAAIKEAGNVKR 107





Solanum tuberosum (taxid: 4113)
EC: 1EC: .EC: 3EC: .EC: 1EC: .EC: -
>sp|E1U332|ALL12_OLEEU Isoflavone reductase-like protein OS=Olea europaea PE=1 SV=1 Back     alignment and function description
>sp|P52579|IFRH_TOBAC Isoflavone reductase homolog A622 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P52577|IFRH_ARATH Isoflavone reductase homolog P3 OS=Arabidopsis thaliana GN=At1g75280 PE=1 SV=1 Back     alignment and function description
>sp|P52575|IFR_MEDSA Isoflavone reductase OS=Medicago sativa GN=IFR PE=1 SV=1 Back     alignment and function description
>sp|Q00016|IFR_CICAR Isoflavone reductase OS=Cicer arietinum GN=IFR PE=1 SV=1 Back     alignment and function description
>sp|P52580|IFRH_MAIZE Isoflavone reductase homolog IRL OS=Zea mays GN=IRL PE=2 SV=1 Back     alignment and function description
>sp|P52576|IFR_PEA Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 SV=1 Back     alignment and function description
>sp|Q15GI4|EGS1_OCIBA Eugenol synthase 1 OS=Ocimum basilicum GN=EGS1 PE=1 SV=1 Back     alignment and function description
>sp|Q15GI3|IGS1_PETHY Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
388499526 310 unknown [Medicago truncatula] 0.681 0.345 0.757 2e-38
1708422 308 RecName: Full=Isoflavone reductase homol 0.681 0.347 0.766 2e-38
255640090 310 unknown [Glycine max] 0.636 0.322 0.8 3e-38
351726399 310 isoflavone reductase homolog 2 [Glycine 0.636 0.322 0.8 3e-38
118486357 306 unknown [Populus trichocarpa] 0.656 0.336 0.766 5e-38
3243234 308 isoflavone reductase related protein [Py 0.681 0.347 0.738 8e-38
6525021 310 isoflavone reductase-like NAD(P)H-depend 0.681 0.345 0.738 1e-37
255637547 310 unknown [Glycine max] 0.636 0.322 0.79 1e-37
124488476 308 phenylcoumaran benzylic ether reductase- 0.681 0.347 0.728 6e-37
224105373 306 phenylcoumaran benzylic ether reductase 0.656 0.336 0.757 8e-37
>gi|388499526|gb|AFK37829.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 81/107 (75%), Positives = 90/107 (84%)

Query: 1   MASKSKILFIGGTGYIGKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLV 60
           MA KSKILFIGGTGYIGK  VEAS KAGHPTF LVREST++ P+K+ LL++FK LGVNLV
Sbjct: 1   MAEKSKILFIGGTGYIGKHIVEASAKAGHPTFALVRESTLADPAKANLLNNFKTLGVNLV 60

Query: 61  IGDVLNHESLVKAIKQVDVVISTVGHTLLADQVKIIAAIKEAEGASR 107
            GD+ NHE+LVKAIKQVDVVISTVGH  + DQVKIIAAIKEA    R
Sbjct: 61  PGDLYNHENLVKAIKQVDVVISTVGHAQIEDQVKIIAAIKEAGNVKR 107




Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|1708422|sp|P52578.1|IFRH_SOLTU RecName: Full=Isoflavone reductase homolog; AltName: Full=CP100 gi|1030068|emb|CAA63056.1| NAD(P)H oxidoreductase, isoflavone reductase homologue [Solanum tuberosum] Back     alignment and taxonomy information
>gi|255640090|gb|ACU20336.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|351726399|ref|NP_001237637.1| isoflavone reductase homolog 2 [Glycine max] gi|6573171|gb|AAF17578.1|AF202184_1 isoflavone reductase homolog 2 [Glycine max] Back     alignment and taxonomy information
>gi|118486357|gb|ABK95019.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|3243234|gb|AAC24001.1| isoflavone reductase related protein [Pyrus communis] Back     alignment and taxonomy information
>gi|6525021|gb|AAF15291.1|AF201458_1 isoflavone reductase-like NAD(P)H-dependent oxidoreductase [Medicago sativa] Back     alignment and taxonomy information
>gi|255637547|gb|ACU19100.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|124488476|gb|ABN12322.1| phenylcoumaran benzylic ether reductase-like protein [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|224105373|ref|XP_002313788.1| phenylcoumaran benzylic ether reductase 3 [Populus trichocarpa] gi|222850196|gb|EEE87743.1| phenylcoumaran benzylic ether reductase 3 [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
TAIR|locus:2136383 308 AT4G39230 [Arabidopsis thalian 0.585 0.298 0.663 9.1e-29
TAIR|locus:2025192 310 AT1G75280 [Arabidopsis thalian 0.585 0.296 0.677 1.5e-26
TAIR|locus:2025167 322 AT1G75300 [Arabidopsis thalian 0.566 0.276 0.651 3.2e-26
TAIR|locus:2025197 318 AT1G75290 [Arabidopsis thalian 0.585 0.289 0.634 7.6e-25
TAIR|locus:2016482 310 AT1G19540 [Arabidopsis thalian 0.515 0.261 0.629 3.9e-21
TAIR|locus:2119455 317 PRR2 "pinoresinol reductase 2" 0.515 0.255 0.469 3e-13
TAIR|locus:2031730 317 PRR1 "pinoresinol reductase 1" 0.515 0.255 0.456 1.8e-12
TAIR|locus:2139494 306 AT4G34540 [Arabidopsis thalian 0.535 0.274 0.415 1e-11
ASPGD|ASPL0000047359 312 AN8968 [Emericella nidulans (t 0.560 0.282 0.273 2.9e-06
TAIR|locus:2180019 417 PCB2 "PALE-GREEN AND CHLOROPHY 0.471 0.177 0.365 2.1e-05
TAIR|locus:2136383 AT4G39230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 320 (117.7 bits), Expect = 9.1e-29, P = 9.1e-29
 Identities = 61/92 (66%), Positives = 76/92 (82%)

Query:     1 MASKSKILFIGGTGYIGKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLV 60
             M SKSKILFIGGTGYIGK+ VEAS ++GHPT VLVR ST++ PS+S  +++FKNLGV  +
Sbjct:     1 MTSKSKILFIGGTGYIGKYIVEASARSGHPTLVLVRNSTLTSPSRSSTIENFKNLGVQFL 60

Query:    61 IGDVLNHESLVKAIKQVDVVISTVGHTLLADQ 92
             +GD+ +H SLV +IKQ DVVISTVGH+LL  Q
Sbjct:    61 LGDLDDHTSLVNSIKQADVVISTVGHSLLGHQ 92




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0032442 "phenylcoumaran benzylic ether reductase activity" evidence=ISS
GO:0046686 "response to cadmium ion" evidence=IEP
TAIR|locus:2025192 AT1G75280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025167 AT1G75300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025197 AT1G75290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016482 AT1G19540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119455 PRR2 "pinoresinol reductase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031730 PRR1 "pinoresinol reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139494 AT4G34540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000047359 AN8968 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2180019 PCB2 "PALE-GREEN AND CHLOROPHYLL B REDUCED 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
PCBER3
SubName- Full=Putative uncharacterized protein; (307 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
pfam05368232 pfam05368, NmrA, NmrA-like family 8e-33
cd05259 282 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ethe 2e-23
cd05243203 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 1e-13
PLN02657 390 PLN02657, PLN02657, 3,8-divinyl protochlorophyllid 1e-12
cd05226176 cd05226, SDR_e_a, Extended (e) and atypical (a) SD 8e-12
cd05244207 cd05244, BVR-B_like_SDR_a, biliverdin IX beta redu 1e-11
cd05269 272 cd05269, TMR_SDR_a, triphenylmethane reductase (TM 4e-10
cd05228 318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 1e-09
pfam13460182 pfam13460, NAD_binding_10, NADH(P)-binding 5e-09
cd05265 250 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 1e-08
cd05267203 cd05267, SDR_a6, atypical (a) SDRs, subgroup 6 3e-07
COG0702 275 COG0702, COG0702, Predicted nucleoside-diphosphate 3e-07
cd05247 323 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, 6e-07
cd05271 273 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ub 1e-06
COG2910211 COG2910, COG2910, Putative NADH-flavin reductase [ 3e-06
cd05262 291 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7 2e-05
TIGR01179 328 TIGR01179, galE, UDP-glucose-4-epimerase GalE 3e-05
pfam03435 380 pfam03435, Saccharop_dh, Saccharopine dehydrogenas 3e-05
cd05245 293 cd05245, SDR_a2, atypical (a) SDRs, subgroup 2 5e-05
COG1087 329 COG1087, GalE, UDP-glucose 4-epimerase [Cell envel 6e-05
TIGR03466 328 TIGR03466, HpnA, hopanoid-associated sugar epimera 7e-05
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 9e-05
cd05231 259 cd05231, NmrA_TMR_like_1_SDR_a, NmrA (a transcript 1e-04
COG0451 314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 2e-04
cd05264 300 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase 4e-04
pfam01073 280 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydr 5e-04
cd05229 302 cd05229, SDR_a3, atypical (a) SDRs, subgroup 3 0.002
cd05257 316 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, 0.003
>gnl|CDD|191263 pfam05368, NmrA, NmrA-like family Back     alignment and domain information
 Score =  115 bits (291), Expect = 8e-33
 Identities = 47/99 (47%), Positives = 56/99 (56%), Gaps = 9/99 (9%)

Query: 7   ILFIGGTGYIGKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLN 66
           IL  G TGY G   V AS+KAGHP   LVR+       KS+L    K  GV LV GD+ +
Sbjct: 1   ILVFGATGYQGGSVVRASLKAGHPVRALVRDP------KSELAKSLKAAGVELVEGDLDD 54

Query: 67  HESLVKAIKQVDVVISTVG---HTLLADQVKIIAAIKEA 102
           HESLV+A+K VDVV S  G      + D  K+  A KEA
Sbjct: 55  HESLVEALKGVDVVFSVTGFWLSKEIEDGKKLADAAKEA 93


NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA. NmrA is part of a system controlling nitrogen metabolite repression in fungi. This family only contains a few sequences as iteration results in significant matches to other Rossmann fold families. Length = 232

>gnl|CDD|187569 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ether reductase (PCBER) like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187554 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 Back     alignment and domain information
>gnl|CDD|178263 PLN02657, PLN02657, 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187555 cd05244, BVR-B_like_SDR_a, biliverdin IX beta reductase (BVR-B, aka flavin reductase)-like proteins; atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187578 cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|222146 pfam13460, NAD_binding_10, NADH(P)-binding Back     alignment and domain information
>gnl|CDD|187575 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|187577 cd05267, SDR_a6, atypical (a) SDRs, subgroup 6 Back     alignment and domain information
>gnl|CDD|223774 COG0702, COG0702, Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|187558 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187579 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|225462 COG2910, COG2910, Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|187572 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7 Back     alignment and domain information
>gnl|CDD|213592 TIGR01179, galE, UDP-glucose-4-epimerase GalE Back     alignment and domain information
>gnl|CDD|217556 pfam03435, Saccharop_dh, Saccharopine dehydrogenase Back     alignment and domain information
>gnl|CDD|187556 cd05245, SDR_a2, atypical (a) SDRs, subgroup 2 Back     alignment and domain information
>gnl|CDD|224012 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|187542 cd05231, NmrA_TMR_like_1_SDR_a, NmrA (a transcriptional regulator) and triphenylmethane reductase (TMR) like proteins, subgroup 1, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|187574 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase (G4E), subgroup 5, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|216283 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydrogenase/isomerase family Back     alignment and domain information
>gnl|CDD|187540 cd05229, SDR_a3, atypical (a) SDRs, subgroup 3 Back     alignment and domain information
>gnl|CDD|187567 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, extended (e) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 157
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.92
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 99.9
KOG1502 327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.89
PF01073 280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.89
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.87
PLN00198 338 anthocyanidin reductase; Provisional 99.86
PLN02650 351 dihydroflavonol-4-reductase 99.86
PLN02572 442 UDP-sulfoquinovose synthase 99.85
PLN02427 386 UDP-apiose/xylose synthase 99.84
PLN02214 342 cinnamoyl-CoA reductase 99.84
PLN02695 370 GDP-D-mannose-3',5'-epimerase 99.84
KOG1371 343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 99.84
PLN02653 340 GDP-mannose 4,6-dehydratase 99.84
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 99.83
PLN02896 353 cinnamyl-alcohol dehydrogenase 99.83
CHL00194 317 ycf39 Ycf39; Provisional 99.83
PRK10675 338 UDP-galactose-4-epimerase; Provisional 99.83
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.83
PLN02240 352 UDP-glucose 4-epimerase 99.83
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 99.82
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 99.82
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 99.82
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 99.82
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.82
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.82
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.82
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 99.81
COG1088 340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.81
COG0300265 DltE Short-chain dehydrogenases of various substra 99.8
PLN02686 367 cinnamoyl-CoA reductase 99.8
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.8
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.79
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.79
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 99.79
PRK06180 277 short chain dehydrogenase; Provisional 99.79
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.78
PLN02166 436 dTDP-glucose 4,6-dehydratase 99.78
PLN02260 668 probable rhamnose biosynthetic enzyme 99.78
KOG1430 361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 99.78
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.78
PRK06482 276 short chain dehydrogenase; Provisional 99.78
PLN02206 442 UDP-glucuronate decarboxylase 99.78
PRK05993 277 short chain dehydrogenase; Provisional 99.77
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 99.77
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 99.77
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.77
PLN02583 297 cinnamoyl-CoA reductase 99.76
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 99.76
PLN03209 576 translocon at the inner envelope of chloroplast su 99.76
PRK06179270 short chain dehydrogenase; Provisional 99.75
PRK06194287 hypothetical protein; Provisional 99.75
PRK06182 273 short chain dehydrogenase; Validated 99.75
PRK09186256 flagellin modification protein A; Provisional 99.75
PRK08263275 short chain dehydrogenase; Provisional 99.75
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.75
PRK07201 657 short chain dehydrogenase; Provisional 99.75
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.74
PRK09291257 short chain dehydrogenase; Provisional 99.74
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.74
PRK07806248 short chain dehydrogenase; Provisional 99.74
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.74
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 99.73
PRK07024257 short chain dehydrogenase; Provisional 99.73
PRK10538248 malonic semialdehyde reductase; Provisional 99.73
PRK07825273 short chain dehydrogenase; Provisional 99.72
COG1091 281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 99.72
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.72
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.72
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.72
PLN02996 491 fatty acyl-CoA reductase 99.71
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.71
PRK08219227 short chain dehydrogenase; Provisional 99.71
PRK08267260 short chain dehydrogenase; Provisional 99.71
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.71
PRK06197 306 short chain dehydrogenase; Provisional 99.71
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.71
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.71
PLN00016 378 RNA-binding protein; Provisional 99.71
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.71
PRK08339263 short chain dehydrogenase; Provisional 99.71
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.7
PRK05866293 short chain dehydrogenase; Provisional 99.7
PRK07102243 short chain dehydrogenase; Provisional 99.7
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.7
TIGR01746 367 Thioester-redct thioester reductase domain. It has 99.7
PRK08251248 short chain dehydrogenase; Provisional 99.7
PRK05717255 oxidoreductase; Validated 99.7
PRK06138252 short chain dehydrogenase; Provisional 99.7
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.7
PRK07454241 short chain dehydrogenase; Provisional 99.7
PRK06196 315 oxidoreductase; Provisional 99.69
PRK06914 280 short chain dehydrogenase; Provisional 99.69
PRK07453 322 protochlorophyllide oxidoreductase; Validated 99.69
PRK07063260 short chain dehydrogenase; Provisional 99.69
PRK06398258 aldose dehydrogenase; Validated 99.69
PRK07478254 short chain dehydrogenase; Provisional 99.69
PRK07109 334 short chain dehydrogenase; Provisional 99.69
PRK07774250 short chain dehydrogenase; Provisional 99.68
PRK05876275 short chain dehydrogenase; Provisional 99.68
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.68
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.68
PRK07023243 short chain dehydrogenase; Provisional 99.68
COG3320 382 Putative dehydrogenase domain of multifunctional n 99.68
PRK08265261 short chain dehydrogenase; Provisional 99.68
PRK07814263 short chain dehydrogenase; Provisional 99.68
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.68
PRK05854 313 short chain dehydrogenase; Provisional 99.68
PRK05650270 short chain dehydrogenase; Provisional 99.68
PRK06841255 short chain dehydrogenase; Provisional 99.68
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.68
PRK07904253 short chain dehydrogenase; Provisional 99.67
PRK05875276 short chain dehydrogenase; Provisional 99.67
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.67
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.67
PRK07890258 short chain dehydrogenase; Provisional 99.67
PRK06523260 short chain dehydrogenase; Provisional 99.67
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.67
PRK12827249 short chain dehydrogenase; Provisional 99.67
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.67
PRK07067257 sorbitol dehydrogenase; Provisional 99.67
PRK12746254 short chain dehydrogenase; Provisional 99.67
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 99.67
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.67
PRK07775274 short chain dehydrogenase; Provisional 99.67
PRK08643256 acetoin reductase; Validated 99.67
PRK12828239 short chain dehydrogenase; Provisional 99.67
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.67
PRK09135249 pteridine reductase; Provisional 99.67
PRK07062265 short chain dehydrogenase; Provisional 99.67
PRK06139 330 short chain dehydrogenase; Provisional 99.67
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.67
PRK06114254 short chain dehydrogenase; Provisional 99.66
COG1089 345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.66
PRK08589272 short chain dehydrogenase; Validated 99.66
PLN02253280 xanthoxin dehydrogenase 99.66
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.66
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.66
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.66
PRK08264238 short chain dehydrogenase; Validated 99.66
PRK07577234 short chain dehydrogenase; Provisional 99.66
PRK06128300 oxidoreductase; Provisional 99.66
PRK12939250 short chain dehydrogenase; Provisional 99.66
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.66
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.66
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.65
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.65
PRK07326237 short chain dehydrogenase; Provisional 99.65
PRK07074257 short chain dehydrogenase; Provisional 99.65
PRK05693 274 short chain dehydrogenase; Provisional 99.65
PLN02778 298 3,5-epimerase/4-reductase 99.65
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.65
PRK06172253 short chain dehydrogenase; Provisional 99.65
PRK07060245 short chain dehydrogenase; Provisional 99.65
PRK07856252 short chain dehydrogenase; Provisional 99.65
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.65
PRK05865 854 hypothetical protein; Provisional 99.64
PRK05867253 short chain dehydrogenase; Provisional 99.64
PRK07985294 oxidoreductase; Provisional 99.64
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.64
PRK09242257 tropinone reductase; Provisional 99.64
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.64
PRK08226263 short chain dehydrogenase; Provisional 99.64
PRK06500249 short chain dehydrogenase; Provisional 99.64
PRK12320 699 hypothetical protein; Provisional 99.64
PRK08177225 short chain dehydrogenase; Provisional 99.64
PRK12937245 short chain dehydrogenase; Provisional 99.63
PRK12743256 oxidoreductase; Provisional 99.63
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.63
PRK07069251 short chain dehydrogenase; Validated 99.63
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.63
PRK08017256 oxidoreductase; Provisional 99.63
PRK06701290 short chain dehydrogenase; Provisional 99.63
PRK06101240 short chain dehydrogenase; Provisional 99.63
PRK08628258 short chain dehydrogenase; Provisional 99.63
PRK06924251 short chain dehydrogenase; Provisional 99.63
PRK09072263 short chain dehydrogenase; Provisional 99.63
KOG0747 331 consensus Putative NAD+-dependent epimerases [Carb 99.63
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.63
PRK06057255 short chain dehydrogenase; Provisional 99.63
PRK09134258 short chain dehydrogenase; Provisional 99.62
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 99.62
PRK08278273 short chain dehydrogenase; Provisional 99.62
PRK12829264 short chain dehydrogenase; Provisional 99.62
PRK08340259 glucose-1-dehydrogenase; Provisional 99.62
PRK07035252 short chain dehydrogenase; Provisional 99.62
PRK12747252 short chain dehydrogenase; Provisional 99.62
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.62
PRK05855582 short chain dehydrogenase; Validated 99.62
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.62
PLN02503 605 fatty acyl-CoA reductase 2 99.61
PRK05872 296 short chain dehydrogenase; Provisional 99.61
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.61
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.61
PRK06947248 glucose-1-dehydrogenase; Provisional 99.61
PRK08277278 D-mannonate oxidoreductase; Provisional 99.6
PRK06949258 short chain dehydrogenase; Provisional 99.6
PRK05599246 hypothetical protein; Provisional 99.6
KOG1208314 consensus Dehydrogenases with different specificit 99.6
PRK08936261 glucose-1-dehydrogenase; Provisional 99.6
PRK06483236 dihydromonapterin reductase; Provisional 99.6
PRK06181263 short chain dehydrogenase; Provisional 99.6
PRK07201 657 short chain dehydrogenase; Provisional 99.6
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.6
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.6
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.6
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.59
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.59
PRK06125259 short chain dehydrogenase; Provisional 99.58
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 99.58
PRK07677252 short chain dehydrogenase; Provisional 99.58
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.58
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.58
PRK07832272 short chain dehydrogenase; Provisional 99.58
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.58
PRK05884223 short chain dehydrogenase; Provisional 99.57
PRK06198260 short chain dehydrogenase; Provisional 99.57
PLN02780320 ketoreductase/ oxidoreductase 99.57
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.57
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.57
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.57
PRK07576264 short chain dehydrogenase; Provisional 99.57
PRK06484520 short chain dehydrogenase; Validated 99.57
PRK07041230 short chain dehydrogenase; Provisional 99.57
PRK12744257 short chain dehydrogenase; Provisional 99.57
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.57
PRK06123248 short chain dehydrogenase; Provisional 99.57
KOG2865 391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 99.56
PRK08703239 short chain dehydrogenase; Provisional 99.56
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.56
PRK07791286 short chain dehydrogenase; Provisional 99.56
PRK12742237 oxidoreductase; Provisional 99.56
KOG1429 350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 99.56
PRK07831262 short chain dehydrogenase; Provisional 99.56
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.55
PRK06484 520 short chain dehydrogenase; Validated 99.55
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.55
PRK08324681 short chain dehydrogenase; Validated 99.54
PRK08862227 short chain dehydrogenase; Provisional 99.54
PRK06953222 short chain dehydrogenase; Provisional 99.54
PRK08303 305 short chain dehydrogenase; Provisional 99.54
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.53
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.53
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.53
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.53
KOG1611249 consensus Predicted short chain-type dehydrogenase 99.53
PRK09009235 C factor cell-cell signaling protein; Provisional 99.52
PRK12367245 short chain dehydrogenase; Provisional 99.52
KOG1209 289 consensus 1-Acyl dihydroxyacetone phosphate reduct 99.52
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.52
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.52
PLN02260 668 probable rhamnose biosynthetic enzyme 99.52
COG2910211 Putative NADH-flavin reductase [General function p 99.51
KOG1610 322 consensus Corticosteroid 11-beta-dehydrogenase and 99.51
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.51
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.51
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.5
PRK06940 275 short chain dehydrogenase; Provisional 99.5
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.5
COG1090 297 Predicted nucleoside-diphosphate sugar epimerase [ 99.5
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.49
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 99.49
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.48
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.48
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.48
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.47
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.47
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.46
PLN00015 308 protochlorophyllide reductase 99.46
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 99.46
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.46
TIGR02685 267 pter_reduc_Leis pteridine reductase. Pteridine red 99.45
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.45
COG0702 275 Predicted nucleoside-diphosphate-sugar epimerases 99.43
COG1028251 FabG Dehydrogenases with different specificities ( 99.42
PRK07578199 short chain dehydrogenase; Provisional 99.42
KOG0725270 consensus Reductases with broad range of substrate 99.41
PRK08309177 short chain dehydrogenase; Provisional 99.36
PRK06720169 hypothetical protein; Provisional 99.35
KOG1372 376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 99.35
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 99.34
PLN02730303 enoyl-[acyl-carrier-protein] reductase 99.34
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 99.32
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 99.28
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 99.27
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 99.24
KOG1221 467 consensus Acyl-CoA reductase [Lipid transport and 99.15
KOG1203 411 consensus Predicted dehydrogenase [Carbohydrate tr 99.15
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.14
KOG1478 341 consensus 3-keto sterol reductase [Lipid transport 99.13
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 99.12
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 99.09
KOG1210 331 consensus Predicted 3-ketosphinganine reductase [S 99.09
TIGR00715 256 precor6x_red precorrin-6x reductase. This enzyme w 99.06
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 99.01
PTZ00325 321 malate dehydrogenase; Provisional 98.93
KOG2733 423 consensus Uncharacterized membrane protein [Functi 98.9
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 98.86
PRK09620229 hypothetical protein; Provisional 98.84
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 98.84
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 98.82
KOG1431 315 consensus GDP-L-fucose synthetase [Carbohydrate tr 98.81
PLN00106 323 malate dehydrogenase 98.81
PRK06732229 phosphopantothenate--cysteine ligase; Validated 98.8
KOG2774 366 consensus NAD dependent epimerase [General functio 98.74
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 98.71
COG3268 382 Uncharacterized conserved protein [Function unknow 98.61
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 98.59
COG0569225 TrkA K+ transport systems, NAD-binding component [ 98.58
PRK12548289 shikimate 5-dehydrogenase; Provisional 98.55
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 98.51
PRK05086 312 malate dehydrogenase; Provisional 98.51
PRK14982340 acyl-ACP reductase; Provisional 98.48
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 98.44
KOG1204253 consensus Predicted dehydrogenase [Secondary metab 98.42
PLN02968 381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 98.42
PRK05671 336 aspartate-semialdehyde dehydrogenase; Reviewed 98.41
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 98.41
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 98.4
COG0623259 FabI Enoyl-[acyl-carrier-protein] 98.38
PRK08057 248 cobalt-precorrin-6x reductase; Reviewed 98.36
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 98.35
PRK09496 453 trkA potassium transporter peripheral membrane com 98.35
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 98.34
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 98.34
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.33
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 98.3
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 98.26
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 98.24
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 98.22
PRK09496453 trkA potassium transporter peripheral membrane com 98.18
PRK08664 349 aspartate-semialdehyde dehydrogenase; Reviewed 98.15
cd05294 309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 98.14
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 98.13
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 98.12
PF02571 249 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: 98.09
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 98.04
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 98.04
TIGR01296 339 asd_B aspartate-semialdehyde dehydrogenase (peptid 98.03
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 98.02
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 98.02
PRK10669558 putative cation:proton antiport protein; Provision 98.0
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.99
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.97
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 97.97
PRK04148134 hypothetical protein; Provisional 97.96
PRK03659601 glutathione-regulated potassium-efflux system prot 97.96
cd01337 310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 97.94
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 97.93
PRK00048 257 dihydrodipicolinate reductase; Provisional 97.9
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 97.9
KOG4288283 consensus Predicted oxidoreductase [General functi 97.89
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 97.88
cd01483143 E1_enzyme_family Superfamily of activating enzymes 97.87
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 97.85
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.85
PLN02383 344 aspartate semialdehyde dehydrogenase 97.83
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 97.83
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 97.83
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 97.82
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 97.8
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 97.8
TIGR01772 312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 97.8
PRK05442 326 malate dehydrogenase; Provisional 97.8
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 97.78
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.78
PRK08040 336 putative semialdehyde dehydrogenase; Provisional 97.76
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 97.76
COG2099 257 CobK Precorrin-6x reductase [Coenzyme metabolism] 97.76
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.75
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 97.75
PRK08655 437 prephenate dehydrogenase; Provisional 97.74
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 97.73
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 97.73
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 97.72
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 97.71
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 97.71
PRK03562621 glutathione-regulated potassium-efflux system prot 97.71
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 97.71
PRK06223 307 malate dehydrogenase; Reviewed 97.71
TIGR03693 637 ocin_ThiF_like putative thiazole-containing bacter 97.71
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 97.7
COG2130340 Putative NADP-dependent oxidoreductases [General f 97.66
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.66
PRK08223287 hypothetical protein; Validated 97.66
PRK11880 267 pyrroline-5-carboxylate reductase; Reviewed 97.66
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 97.65
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 97.65
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 97.64
COG0289 266 DapB Dihydrodipicolinate reductase [Amino acid tra 97.64
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 97.61
PRK13940414 glutamyl-tRNA reductase; Provisional 97.61
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.61
COG0002 349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 97.61
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 97.6
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.59
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 97.59
PRK11863 313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 97.59
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.58
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 97.58
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 97.58
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.58
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 97.57
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 97.57
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 97.56
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 97.56
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.56
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 97.55
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.55
PRK15116268 sulfur acceptor protein CsdL; Provisional 97.54
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.54
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 97.54
PRK06598 369 aspartate-semialdehyde dehydrogenase; Reviewed 97.53
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 97.53
PRK10537393 voltage-gated potassium channel; Provisional 97.52
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 97.52
PTZ00117 319 malate dehydrogenase; Provisional 97.51
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.51
TIGR00978 341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 97.49
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 97.49
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.49
PLN02602 350 lactate dehydrogenase 97.49
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.47
PRK14027283 quinate/shikimate dehydrogenase; Provisional 97.47
PRK08328231 hypothetical protein; Provisional 97.46
PLN00112 444 malate dehydrogenase (NADP); Provisional 97.46
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.46
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 97.45
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 97.45
PRK06849 389 hypothetical protein; Provisional 97.44
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 97.43
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 97.43
PLN00203 519 glutamyl-tRNA reductase 97.42
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 97.42
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.41
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.41
PRK13302 271 putative L-aspartate dehydrogenase; Provisional 97.41
KOG0172 445 consensus Lysine-ketoglutarate reductase/saccharop 97.39
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 97.38
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 97.38
cd01489 312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 97.37
PRK06728 347 aspartate-semialdehyde dehydrogenase; Provisional 97.37
KOG1494 345 consensus NAD-dependent malate dehydrogenase [Ener 97.37
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.37
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 97.37
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 97.37
TIGR01763 305 MalateDH_bact malate dehydrogenase, NAD-dependent. 97.37
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 97.36
COG0039 313 Mdh Malate/lactate dehydrogenases [Energy producti 97.36
PRK07634 245 pyrroline-5-carboxylate reductase; Reviewed 97.36
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 97.36
PRK14851 679 hypothetical protein; Provisional 97.36
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 97.35
TIGR01851 310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 97.35
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 97.34
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 97.33
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 97.33
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 97.32
PRK07679 279 pyrroline-5-carboxylate reductase; Reviewed 97.32
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 97.31
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.29
PTZ00082 321 L-lactate dehydrogenase; Provisional 97.28
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 97.27
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.25
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 97.25
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.24
PRK06719157 precorrin-2 dehydrogenase; Validated 97.23
KOG1196343 consensus Predicted NAD-dependent oxidoreductase [ 97.23
PRK06019 372 phosphoribosylaminoimidazole carboxylase ATPase su 97.23
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 97.23
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 97.23
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 97.23
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 97.22
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 97.22
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 97.21
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 97.21
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.2
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.2
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 97.2
PRK07417 279 arogenate dehydrogenase; Reviewed 97.19
PLN02353 473 probable UDP-glucose 6-dehydrogenase 97.18
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.17
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 97.17
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.17
PRK14852 989 hypothetical protein; Provisional 97.17
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 97.17
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 97.16
PLN02928347 oxidoreductase family protein 97.14
PRK05447 385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 97.13
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 97.12
COG0136 334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 97.12
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 97.11
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 97.11
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 97.11
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.11
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 97.09
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 97.09
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2 97.08
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 97.06
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.05
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 97.04
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
Probab=99.92  E-value=2.7e-24  Score=158.72  Aligned_cols=135  Identities=20%  Similarity=0.297  Sum_probs=114.6

Q ss_pred             CeEEEEcCCCcchHHHHHHHHhCCCcEEEEecCCCCCCCchhhHhhhhcCCCeEEEEccCCChHHHHHHhc--CcCEEEE
Q 040431            5 SKILFIGGTGYIGKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIK--QVDVVIS   82 (157)
Q Consensus         5 ~~ilitGatG~iG~~l~~~l~~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~~v~~~~~D~~~~~~~~~~~~--~~d~vv~   82 (157)
                      |+||||||.||||+|.|.+|++.|++|+++++-..+. .+.+.      ...+.++++|+.|.+.+.++|.  ++|+|+|
T Consensus         1 ~~iLVtGGAGYIGSHtv~~Ll~~G~~vvV~DNL~~g~-~~~v~------~~~~~f~~gDi~D~~~L~~vf~~~~idaViH   73 (329)
T COG1087           1 MKVLVTGGAGYIGSHTVRQLLKTGHEVVVLDNLSNGH-KIALL------KLQFKFYEGDLLDRALLTAVFEENKIDAVVH   73 (329)
T ss_pred             CeEEEecCcchhHHHHHHHHHHCCCeEEEEecCCCCC-HHHhh------hccCceEEeccccHHHHHHHHHhcCCCEEEE
Confidence            5899999999999999999999999999999876654 22221      1126899999999999999997  6999999


Q ss_pred             cCCCcc---------------hHHHHHHHHHHHHhcCCccEEEeccccccccCCCc------cCCccchhhHhHhhhhHH
Q 040431           83 TVGHTL---------------LADQVKIIAAIKEAEGASRGTLRTQKGKMSSLSSE------MTTTLDMLEMTELIDQKI  141 (157)
Q Consensus        83 ~a~~~~---------------~~~~~~l~~~~~~~~~~~~~v~~Ss~~~~~~~~~~------~~~~~~~~~~~~~~~~~~  141 (157)
                      +||...               +.++..|+++|.+.+ +++|||.||.++|+.....      ...|.++|+.||++.|.+
T Consensus        74 FAa~~~VgESv~~Pl~Yy~NNv~gTl~Ll~am~~~g-v~~~vFSStAavYG~p~~~PI~E~~~~~p~NPYG~sKlm~E~i  152 (329)
T COG1087          74 FAASISVGESVQNPLKYYDNNVVGTLNLIEAMLQTG-VKKFIFSSTAAVYGEPTTSPISETSPLAPINPYGRSKLMSEEI  152 (329)
T ss_pred             CccccccchhhhCHHHHHhhchHhHHHHHHHHHHhC-CCEEEEecchhhcCCCCCcccCCCCCCCCCCcchhHHHHHHHH
Confidence            999876               677999999999999 9999999999999865431      157899999999999999


Q ss_pred             HHHHHh
Q 040431          142 FIYFWG  147 (157)
Q Consensus       142 ~~~~~~  147 (157)
                      +.++..
T Consensus       153 L~d~~~  158 (329)
T COG1087         153 LRDAAK  158 (329)
T ss_pred             HHHHHH
Confidence            666543



>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG4288 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>KOG0172 consensus Lysine-ketoglutarate reductase/saccharopine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
1qyc_A 308 Crystal Structures Of Pinoresinol-Lariciresinol And 2e-22
2gas_A 307 Crystal Structure Of Isoflavone Reductase Length = 1e-20
1qyd_A 313 Crystal Structures Of Pinoresinol-Lariciresinol And 6e-19
3c1o_A 321 The Multiple Phenylpropene Synthases In Both Clarki 1e-17
2qw8_A 314 Structure Of Eugenol Synthase From Ocimum Basilicum 2e-17
2r2g_A 318 Structure Of Eugenol Synthase From Ocimum Basilicum 3e-17
2qx7_A 318 Structure Of Eugenol Synthase From Ocimum Basilicum 3e-17
3c3x_A 318 The Multiple Phenylpropene Synthases In Both Clarki 9e-17
3i52_A 346 Ternary Complex Structure Of Leucoanthocyanidin Red 7e-11
>pdb|1QYC|A Chain A, Crystal Structures Of Pinoresinol-Lariciresinol And Phenylcoumaran Benzylic Ether Reductases, And Their Relationship To Isoflavone Reductases Length = 308 Back     alignment and structure

Iteration: 1

Score = 101 bits (252), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 54/94 (57%), Positives = 68/94 (72%), Gaps = 1/94 (1%) Query: 1 MASKSKILFIGGTGYIGKFTVEASVKAGHPTFVLVRESTISGPS-KSQLLDHFKNLGVNL 59 M S+S+IL IG TGYIG+ +AS+ GHPTF+LVREST S S K+QLL+ FK G N+ Sbjct: 1 MGSRSRILLIGATGYIGRHVAKASLDLGHPTFLLVRESTASSNSEKAQLLESFKASGANI 60 Query: 60 VIGDVLNHESLVKAIKQVDVVISTVGHTLLADQV 93 V G + +H SLV+A+K VDVVISTVG + QV Sbjct: 61 VHGSIDDHASLVEAVKNVDVVISTVGSLQIESQV 94
>pdb|2GAS|A Chain A, Crystal Structure Of Isoflavone Reductase Length = 307 Back     alignment and structure
>pdb|1QYD|A Chain A, Crystal Structures Of Pinoresinol-Lariciresinol And Phenylcoumaran Benzylic Ether Reductases, And Their Relationship To Isoflavone Reductases Length = 313 Back     alignment and structure
>pdb|3C1O|A Chain A, The Multiple Phenylpropene Synthases In Both Clarkia Breweri And Petunia Hybrida Represent Two Distinct Lineages Length = 321 Back     alignment and structure
>pdb|2QW8|A Chain A, Structure Of Eugenol Synthase From Ocimum Basilicum Length = 314 Back     alignment and structure
>pdb|2R2G|A Chain A, Structure Of Eugenol Synthase From Ocimum Basilicum Complexed With Emdf Length = 318 Back     alignment and structure
>pdb|2QX7|A Chain A, Structure Of Eugenol Synthase From Ocimum Basilicum Length = 318 Back     alignment and structure
>pdb|3C3X|A Chain A, The Multiple Phenylpropene Synthases In Both Clarkia Breweri And Petunia Hybrida Represent Two Distinct Lineages Length = 318 Back     alignment and structure
>pdb|3I52|A Chain A, Ternary Complex Structure Of Leucoanthocyanidin Reductase From Vitis Vinifera Length = 346 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 1e-38
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 4e-37
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 3e-36
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 9e-36
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 8e-35
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 2e-33
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 2e-16
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 5e-15
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 7e-15
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 5e-13
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 5e-13
1xq6_A 253 Unknown protein; structural genomics, protein stru 2e-12
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 5e-12
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 8e-12
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 2e-10
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 1e-09
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 3e-07
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 5e-07
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 6e-07
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 6e-07
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 3e-06
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 3e-06
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 4e-06
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 5e-06
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 5e-06
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 6e-06
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 8e-06
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 9e-06
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 3e-05
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 5e-05
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 6e-05
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 7e-05
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 8e-05
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 9e-05
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 9e-05
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 1e-04
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 1e-04
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 1e-04
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 2e-04
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 2e-04
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 2e-04
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 2e-04
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 6e-04
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 7e-04
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 8e-04
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Length = 308 Back     alignment and structure
 Score =  132 bits (333), Expect = 1e-38
 Identities = 60/108 (55%), Positives = 74/108 (68%), Gaps = 1/108 (0%)

Query: 1   MASKSKILFIGGTGYIGKFTVEASVKAGHPTFVLVRESTISG-PSKSQLLDHFKNLGVNL 59
           M S+S+IL IG TGYIG+   +AS+  GHPTF+LVREST S    K+QLL+ FK  G N+
Sbjct: 1   MGSRSRILLIGATGYIGRHVAKASLDLGHPTFLLVRESTASSNSEKAQLLESFKASGANI 60

Query: 60  VIGDVLNHESLVKAIKQVDVVISTVGHTLLADQVKIIAAIKEAEGASR 107
           V G + +H SLV+A+K VDVVISTVG   +  QV II AIKE     R
Sbjct: 61  VHGSIDDHASLVEAVKNVDVVISTVGSLQIESQVNIIKAIKEVGTVKR 108


>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Length = 313 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Length = 321 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Length = 307 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Length = 318 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Length = 346 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Length = 206 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Length = 236 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 3r14_A* Length = 221 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Length = 253 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Length = 219 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Length = 236 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Length = 224 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Length = 221 Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Length = 289 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Length = 267 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Length = 299 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Length = 267 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Length = 286 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Length = 450 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Length = 287 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Length = 364 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Length = 242 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Length = 352 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Length = 311 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Length = 330 Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Length = 322 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Length = 342 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Length = 467 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Length = 342 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Length = 337 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Length = 330 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} Length = 341 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Length = 118 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Length = 344 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Length = 286 Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Length = 348 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Length = 352 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} Length = 313 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Length = 338 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Length = 311 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.92
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 99.92
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.91
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.9
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.9
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.89
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.89
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 99.89
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 99.89
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.89
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.89
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.89
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.89
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.88
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.88
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.88
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.88
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.88
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.88
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.88
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.88
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.88
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 99.87
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.87
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.87
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.87
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.87
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.87
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.87
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 99.87
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.87
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.86
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 99.86
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.86
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.86
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 99.86
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.86
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 99.86
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.86
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 99.86
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.86
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 99.86
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.86
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.86
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.86
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 99.85
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.85
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.85
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.85
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.85
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.85
1xq6_A253 Unknown protein; structural genomics, protein stru 99.85
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 99.85
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.85
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 99.85
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 99.85
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 99.85
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 99.84
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.84
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 99.84
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.84
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.84
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.84
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 99.84
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.84
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 99.83
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 99.83
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.83
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.83
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 99.83
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 99.83
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.82
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.82
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.82
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.82
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.82
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.81
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.81
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.81
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.81
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 99.81
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.81
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.81
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.81
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.81
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.8
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.8
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.8
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.8
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.8
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.8
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.8
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.8
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.8
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.8
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.8
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.8
4f6c_A 427 AUSA reductase domain protein; thioester reductase 99.8
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.79
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.79
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.79
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.79
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.79
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.79
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.79
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.79
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.79
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.79
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.79
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.79
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.79
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.79
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.79
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.79
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.79
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.79
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.79
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.79
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.79
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.79
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.78
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.78
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.78
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.78
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.78
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.78
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.78
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.78
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.78
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.78
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.78
3rih_A293 Short chain dehydrogenase or reductase; structural 99.78
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.78
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.78
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.78
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.78
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.78
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.78
3cxt_A291 Dehydrogenase with different specificities; rossma 99.77
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.77
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.77
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.77
4f6l_B 508 AUSA reductase domain protein; thioester reductase 99.77
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.77
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.77
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.77
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.77
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.77
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 99.77
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.77
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.77
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.77
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.77
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.77
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.77
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.77
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.77
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.77
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.77
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.77
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.77
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.77
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.77
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.77
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.77
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.76
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.76
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.76
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.76
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.76
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.76
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.76
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.76
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.76
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.76
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.76
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.76
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.76
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.76
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.76
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.76
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.76
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.76
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.76
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.76
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.76
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.76
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.76
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.76
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.76
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.75
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.75
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.75
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 99.75
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.75
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.75
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 99.75
1spx_A278 Short-chain reductase family member (5L265); paral 99.75
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.75
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.75
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.75
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.75
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.75
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.75
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.75
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.75
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.75
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.75
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.75
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.75
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.74
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.74
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.74
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.74
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.74
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.74
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.74
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.74
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.74
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.74
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.74
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.74
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.73
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.73
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.73
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.73
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.73
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.73
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.73
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.73
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.73
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.73
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.73
1xkq_A280 Short-chain reductase family member (5D234); parra 99.73
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.73
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.73
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.73
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.72
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 99.72
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.72
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.72
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.72
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.72
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.72
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.72
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.72
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.72
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.72
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.72
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.71
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.71
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.71
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.71
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.71
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.71
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.71
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.71
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.71
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.71
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.7
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.7
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.7
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.7
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.7
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.69
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.69
4e4y_A244 Short chain dehydrogenase family protein; structur 99.69
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.69
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.69
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.69
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.69
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.68
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.68
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.68
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.68
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.68
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.67
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.67
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.67
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.67
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.67
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 99.66
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.66
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.66
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.66
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.66
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.66
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.65
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.65
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.65
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.64
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.64
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.62
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.61
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.6
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.6
1y7t_A 327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 99.59
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 99.57
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.56
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.52
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.52
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.4
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.4
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.39
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.36
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.36
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.36
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.32
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.32
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.32
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 99.29
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.27
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 99.25
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.24
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 99.23
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.23
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 99.21
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 99.2
1id1_A153 Putative potassium channel protein; RCK domain, E. 99.19
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 99.17
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 99.15
1lss_A140 TRK system potassium uptake protein TRKA homolog; 99.15
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 99.15
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.08
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 99.03
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 99.03
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.93
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.87
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 98.86
1hye_A 313 L-lactate/malate dehydrogenase; nucleotide binding 98.85
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 98.84
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 98.82
1o6z_A 303 MDH, malate dehydrogenase; halophilic, ION-binding 98.8
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 98.8
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.78
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 98.77
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 98.73
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 98.7
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 98.65
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 98.65
4g65_A 461 TRK system potassium uptake protein TRKA; structur 98.63
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 98.49
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 98.49
5mdh_A 333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 98.49
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 98.49
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.49
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 98.48
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 98.48
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 98.46
2nqt_A 352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 98.42
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 98.41
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 98.39
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 98.38
1lnq_A336 MTHK channels, potassium channel related protein; 98.37
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 98.36
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 98.36
2hjs_A 340 USG-1 protein homolog; aspartate-semialdehyde dehy 98.35
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 98.32
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 98.29
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 98.24
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 98.23
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 98.22
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 98.22
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 98.19
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 98.19
4f3y_A 272 DHPR, dihydrodipicolinate reductase; structural ge 98.16
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 98.16
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 98.15
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 98.15
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 98.15
3qha_A 296 Putative oxidoreductase; seattle structural genomi 98.12
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 98.12
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 98.12
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 98.11
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 98.11
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 98.11
3gms_A340 Putative NADPH:quinone reductase; structural genom 98.1
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 98.1
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.1
4eye_A342 Probable oxidoreductase; structural genomics, niai 98.09
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 98.07
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 98.07
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 98.07
2ep5_A 350 350AA long hypothetical aspartate-semialdehyde deh 98.06
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 98.04
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 98.03
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 98.02
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 98.01
3ijp_A 288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 98.01
4g65_A461 TRK system potassium uptake protein TRKA; structur 98.0
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.0
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 97.99
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 97.99
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 97.98
1dih_A 273 Dihydrodipicolinate reductase; oxidoreductase; HET 97.97
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 97.95
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 97.95
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 97.95
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 97.95
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 97.95
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 97.94
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 97.94
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 97.93
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.93
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 97.92
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 97.92
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 97.92
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 97.91
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 97.91
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 97.9
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 97.9
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 97.9
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.9
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 97.89
2r00_A 336 Aspartate-semialdehyde dehydrogenase; conformation 97.89
3dr3_A 337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 97.89
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 97.89
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 97.88
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.88
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 97.87
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 97.87
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 97.86
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 97.84
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 97.84
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.84
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 97.84
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 97.84
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 97.83
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.83
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.83
4gx0_A565 TRKA domain protein; membrane protein, ION channel 97.83
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 97.83
3krt_A456 Crotonyl COA reductase; structural genomics, prote 97.81
3d0o_A 317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 97.8
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 97.8
3hhp_A 312 Malate dehydrogenase; MDH, citric acid cycle, TCA 97.79
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 97.78
3hsk_A 381 Aspartate-semialdehyde dehydrogenase; candida albi 97.77
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.76
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 97.76
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 97.76
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 97.74
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 97.72
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.72
4ezb_A 317 Uncharacterized conserved protein; structural geno 97.71
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 97.71
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 97.7
2ahr_A 259 Putative pyrroline carboxylate reductase; pyrrolin 97.69
3k5i_A 403 Phosphoribosyl-aminoimidazole carboxylase; purine 97.69
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 97.69
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 97.67
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 97.67
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 97.66
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 97.66
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 97.65
1t4b_A 367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 97.65
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 97.64
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 97.64
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 97.64
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 97.63
3tl2_A 315 Malate dehydrogenase; center for structural genomi 97.63
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 97.62
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 97.62
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 97.61
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 97.61
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.61
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 97.6
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 97.6
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 97.59
2x0j_A 294 Malate dehydrogenase; oxidoreductase, hyperthermop 97.59
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 97.59
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.58
3pzr_A 370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 97.58
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 97.57
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 97.57
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 97.56
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 97.56
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 97.56
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 97.56
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 97.55
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 97.55
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 97.55
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 97.54
2xxj_A 310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 97.54
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 97.54
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 97.53
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 97.53
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.53
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 97.52
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 97.52
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 97.52
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 97.52
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 97.51
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.51
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 97.51
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.51
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 97.5
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.49
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.49
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 97.49
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
Probab=99.92  E-value=1.4e-24  Score=156.44  Aligned_cols=136  Identities=19%  Similarity=0.263  Sum_probs=110.4

Q ss_pred             CCCCCeEEEEcCCCcchHHHHHHHHhCCCcEEEEecCCCCCCCchhhHhhhhcCCCeEEEEccCCChHHHHHHhcCcCEE
Q 040431            1 MASKSKILFIGGTGYIGKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVV   80 (157)
Q Consensus         1 M~~~~~ilitGatG~iG~~l~~~l~~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~~v~~~~~D~~~~~~~~~~~~~~d~v   80 (157)
                      |++||+|+||||||++|++++++|++.|++|++++|++...     ..+    ..++.++.+|++|++++.++++++|+|
T Consensus         1 M~~m~~ilItGatG~iG~~l~~~L~~~g~~V~~~~r~~~~~-----~~~----~~~~~~~~~Dl~d~~~~~~~~~~~d~v   71 (227)
T 3dhn_A            1 MEKVKKIVLIGASGFVGSALLNEALNRGFEVTAVVRHPEKI-----KIE----NEHLKVKKADVSSLDEVCEVCKGADAV   71 (227)
T ss_dssp             --CCCEEEEETCCHHHHHHHHHHHHTTTCEEEEECSCGGGC-----CCC----CTTEEEECCCTTCHHHHHHHHTTCSEE
T ss_pred             CCCCCEEEEEcCCchHHHHHHHHHHHCCCEEEEEEcCcccc-----hhc----cCceEEEEecCCCHHHHHHHhcCCCEE
Confidence            77678999999999999999999999999999999984332     111    257899999999999999999999999


Q ss_pred             EEcCCCc---------chHHHHHHHHHHHHhcCCccEEEeccccccccCCCc-----cCCccchhhHhHhhhhHHHHHHH
Q 040431           81 ISTVGHT---------LLADQVKIIAAIKEAEGASRGTLRTQKGKMSSLSSE-----MTTTLDMLEMTELIDQKIFIYFW  146 (157)
Q Consensus        81 v~~a~~~---------~~~~~~~l~~~~~~~~~~~~~v~~Ss~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~  146 (157)
                      ||+|+..         +..++.++++++.+.+ +++||++||.+++...+..     ...+...|..+|...+.+ ...+
T Consensus        72 i~~a~~~~~~~~~~~~n~~~~~~l~~~~~~~~-~~~~v~~Ss~~~~~~~~~~~~~~~~~~p~~~Y~~sK~~~e~~-~~~~  149 (227)
T 3dhn_A           72 ISAFNPGWNNPDIYDETIKVYLTIIDGVKKAG-VNRFLMVGGAGSLFIAPGLRLMDSGEVPENILPGVKALGEFY-LNFL  149 (227)
T ss_dssp             EECCCC------CCSHHHHHHHHHHHHHHHTT-CSEEEEECCSTTSEEETTEEGGGTTCSCGGGHHHHHHHHHHH-HHTG
T ss_pred             EEeCcCCCCChhHHHHHHHHHHHHHHHHHHhC-CCEEEEeCChhhccCCCCCccccCCcchHHHHHHHHHHHHHH-HHHH
Confidence            9999987         3778999999999998 8999999998876543321     135678899999998866 4444


Q ss_pred             h
Q 040431          147 G  147 (157)
Q Consensus       147 ~  147 (157)
                      .
T Consensus       150 ~  150 (227)
T 3dhn_A          150 M  150 (227)
T ss_dssp             G
T ss_pred             h
Confidence            3



>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 157
d1qyca_ 307 c.2.1.2 (A:) Phenylcoumaran benzylic ether reducta 1e-15
d1qyda_ 312 c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { 5e-15
d1xgka_ 350 c.2.1.2 (A:) Negative transcriptional regulator Nm 2e-13
d1kewa_ 361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 3e-09
d1udca_ 338 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 6e-09
d1hdoa_205 c.2.1.2 (A:) Biliverdin IX beta reductase {Human ( 2e-08
d1oc2a_ 346 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 4e-08
d1orra_ 338 c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella 5e-08
d1y1pa1 342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 8e-08
d1z45a2 347 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-ep 4e-07
d2b69a1 312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 4e-07
d2blla1 342 c.2.1.2 (A:316-657) Polymyxin resistance protein A 4e-07
d1r6da_ 322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 4e-07
d1db3a_ 357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 5e-07
d1n7ha_ 339 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cr 8e-07
d2c5aa1 363 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T 1e-06
d1rkxa_ 356 c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia 2e-06
d1e6ua_ 315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 2e-06
d1rpna_ 321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 3e-06
d1i24a_ 393 c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 4e-06
d1ek6a_ 346 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 5e-06
d1n2sa_ 298 c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reduct 6e-06
d1t2aa_ 347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 5e-05
d1sb8a_ 341 c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W 4e-04
d2a35a1212 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pse 6e-04
d2q46a1252 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 ( 0.001
d1vl0a_ 281 c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD 0.001
d1gy8a_ 383 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 0.002
d2bkaa1232 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {H 0.003
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Length = 307 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Phenylcoumaran benzylic ether reductase
species: Loblolly pine (Pinus taeda) [TaxId: 3352]
 Score = 69.8 bits (169), Expect = 1e-15
 Identities = 58/101 (57%), Positives = 72/101 (71%), Gaps = 1/101 (0%)

Query: 3   SKSKILFIGGTGYIGKFTVEASVKAGHPTFVLVREST-ISGPSKSQLLDHFKNLGVNLVI 61
           S+S+IL IG TGYIG+   +AS+  GHPTF+LVREST  S   K+QLL+ FK  G N+V 
Sbjct: 2   SRSRILLIGATGYIGRHVAKASLDLGHPTFLLVRESTASSNSEKAQLLESFKASGANIVH 61

Query: 62  GDVLNHESLVKAIKQVDVVISTVGHTLLADQVKIIAAIKEA 102
           G + +H SLV+A+K VDVVISTVG   +  QV II AIKE 
Sbjct: 62  GSIDDHASLVEAVKNVDVVISTVGSLQIESQVNIIKAIKEV 102


>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Length = 350 Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Length = 338 Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 347 Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Length = 342 Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 339 Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Length = 356 Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 393 Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Length = 298 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Length = 212 Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 252 Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Length = 281 Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Length = 383 Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.92
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.91
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.91
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.9
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.9
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.89
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.88
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.88
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.87
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.87
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.87
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.85
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.85
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.85
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.85
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.84
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.84
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.84
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.84
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.82
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.82
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.81
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.81
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.79
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.79
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.78
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.78
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 99.77
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.77
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.77
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.77
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.76
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.76
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.75
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.75
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.75
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.74
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.74
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.74
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.74
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.74
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.73
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.73
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 99.73
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.73
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.73
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.73
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.73
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.73
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.73
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.73
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.72
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.72
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.72
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.72
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.72
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 99.72
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.72
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.72
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.7
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.7
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.69
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.69
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.68
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.67
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.67
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.67
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.67
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.66
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.66
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.66
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.66
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.65
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.63
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.62
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.62
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.6
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.6
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.6
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.6
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.58
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.58
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.58
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.51
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.51
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.49
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.49
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.47
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.38
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.36
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 99.35
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.35
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.27
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 99.23
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 99.09
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.03
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 98.93
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 98.91
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.85
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 98.79
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 98.6
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 98.55
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 98.48
d1id1a_153 Rck domain from putative potassium channel Kch {Es 98.47
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.46
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.41
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 98.39
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 98.39
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 98.39
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 98.38
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 98.37
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 98.35
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 98.32
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.3
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 98.29
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 98.28
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 98.27
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 98.26
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 98.22
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 98.21
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 98.21
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 98.19
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 98.15
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 98.15
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 98.14
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 98.13
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 98.11
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 98.11
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 98.1
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 98.1
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 98.07
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 98.06
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 98.05
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 98.05
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 98.02
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 98.02
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 98.01
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 98.0
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.98
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.97
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.97
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 97.96
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.94
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.93
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 97.92
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 97.92
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 97.92
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.92
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 97.91
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 97.91
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.89
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 97.88
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.88
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.87
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 97.86
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 97.82
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 97.81
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.77
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.77
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 97.74
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.72
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 97.7
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 97.7
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 97.68
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 97.68
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 97.67
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 97.66
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 97.65
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 97.65
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 97.64
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.6
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 97.5
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.48
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 97.47
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.45
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 97.42
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 97.39
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 97.39
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 97.39
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 97.36
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 97.34
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 97.31
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 97.23
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 97.17
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.15
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 97.15
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 97.11
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 97.06
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 97.05
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.05
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 97.04
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 97.04
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.01
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 96.99
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.96
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 96.96
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.95
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.94
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.89
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.87
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.87
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 96.86
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.83
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 96.82
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.78
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.75
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.74
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 96.73
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.72
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 96.68
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 96.68
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 96.68
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 96.67
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 96.66
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 96.65
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.63
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.63
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 96.62
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.61
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 96.6
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 96.59
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 96.57
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 96.57
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.53
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.53
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.51
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 96.47
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.46
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 96.46
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.43
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 96.43
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 96.42
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 96.39
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 96.38
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 96.37
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.36
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 96.33
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 96.32
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 96.28
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 96.28
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 96.23
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 96.22
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 96.21
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 { 96.2
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 96.19
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 96.15
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.06
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.06
d1fmta2206 Methionyl-tRNAfmet formyltransferase {Escherichia 96.05
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.01
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 95.99
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.96
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 95.96
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.95
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.94
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 95.92
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 95.92
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.88
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 95.88
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 95.87
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 95.85
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 95.78
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 95.71
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 95.68
d1xk7a1 402 Crotonobetainyl-CoA:carnitine CoA-transferase, Cai 95.64
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 95.64
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 95.53
d1x74a1 359 2-methylacyl-CoA racemase Mcr {Mycobacterium tuber 95.49
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 95.47
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 95.46
d2vjma1 427 Formyl-CoA transferase {Oxalobacter formigenes [Ta 95.44
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 95.43
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 95.41
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.38
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 95.36
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 95.34
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 95.27
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.24
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 95.23
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 95.15
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.93
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 94.92
d1q7ea_ 417 Hypothetical protein YfdW {Escherichia coli [TaxId 94.91
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 94.66
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 94.62
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 94.6
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 94.56
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 94.43
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 94.42
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 94.4
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 94.35
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 94.35
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 94.26
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 94.23
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 94.09
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 94.07
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 94.05
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 94.02
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 94.0
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 93.9
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 93.85
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 93.83
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.74
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 93.65
d2bisa1 437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 93.49
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 93.45
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 93.37
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 93.26
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 93.26
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 93.18
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 92.84
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 92.66
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 92.58
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 92.55
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 92.42
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 92.24
d1rq2a1198 Cell-division protein FtsZ {Mycobacterium tubercul 92.22
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 92.19
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 92.02
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 91.96
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 91.68
d2csua3163 Acetate-CoA ligase alpha chain, AcdA, domains 2 an 91.48
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 91.3
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 91.27
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 91.26
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 91.24
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 91.19
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 91.18
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 91.05
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 90.74
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 90.48
d1ofua1198 Cell-division protein FtsZ {Pseudomonas aeruginosa 90.42
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.32
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 90.28
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 90.16
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 89.99
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 89.66
d1qkia1203 Glucose 6-phosphate dehydrogenase, N-terminal doma 89.54
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 89.37
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.25
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 89.22
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.18
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 89.13
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 88.99
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 88.92
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 88.81
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 88.77
d1rzua_ 477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 88.71
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 88.71
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 88.68
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 88.65
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 88.48
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 88.07
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 88.03
d1p9oa_ 290 Phosphopantothenoylcysteine synthetase {Human (Hom 88.02
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 87.59
d3bula2156 Methionine synthase, C-terminal domain {Escherichi 87.27
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 87.23
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 87.18
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 87.11
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 87.1
d2j9ga2114 Biotin carboxylase (BC), N-terminal domain {Escher 86.88
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 86.88
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 86.84
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 86.54
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 86.49
d1h9aa1195 Glucose 6-phosphate dehydrogenase, N-terminal doma 86.37
d1jzta_243 Hypothetical protein YNL200c (YNU0_YEAST) {Baker's 86.34
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 86.32
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 86.31
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 86.27
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 86.26
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 86.09
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 85.89
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 85.88
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 85.77
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 85.73
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 85.56
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 85.36
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 85.09
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 85.03
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 84.92
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 84.77
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 84.72
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 84.21
d1rtta_174 Hypothetical protein PA1204 {Pseudomonas aeruginos 83.97
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 83.88
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 83.77
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 83.59
d1pn3a_ 391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 83.47
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 83.24
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 83.14
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 82.89
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 82.85
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 82.75
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 82.39
d2gjca1 311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 82.3
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 81.97
d1iira_ 401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 81.95
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 81.93
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 81.86
d1t0ia_185 Hypothetical protein Ylr011wp {Baker's yeast (Sacc 81.76
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 81.61
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 81.44
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 81.41
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 81.35
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 81.32
d1ulza2114 Biotin carboxylase (BC), N-terminal domain {Aquife 81.18
d1onfa1 259 Glutathione reductase {Plasmodium falciparum [TaxI 81.16
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 80.92
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 80.83
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 80.63
d1jyea_ 271 Lac-repressor (lacR) core (C-terminal domain) {Esc 80.36
d1cf3a1 385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 80.14
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 80.06
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase)
species: Escherichia coli [TaxId: 562]
Probab=99.92  E-value=2e-24  Score=162.66  Aligned_cols=141  Identities=18%  Similarity=0.296  Sum_probs=115.8

Q ss_pred             CeEEEEcCCCcchHHHHHHHHhCCCcEEEEecCCCCCCCchhhHhhhhcCCCeEEEEccCCChHHHHHHhc--CcCEEEE
Q 040431            5 SKILFIGGTGYIGKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIK--QVDVVIS   82 (157)
Q Consensus         5 ~~ilitGatG~iG~~l~~~l~~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~~v~~~~~D~~~~~~~~~~~~--~~d~vv~   82 (157)
                      |||||||||||||++|++.|+++|++|++++|..... .............++.++++|++|.+.+.++++  ++|+|||
T Consensus         1 MKiLItG~tGfIG~~l~~~L~~~g~~V~~~d~~~~~~-~~~~~~~~~~~~~~~~~~~~Dl~d~~~l~~~~~~~~~d~ViH   79 (338)
T d1udca_           1 MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSK-RSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIH   79 (338)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHHTTCEEEEEECCSSCC-TTHHHHHHHHHTSCCEEEECCTTCHHHHHHHHHHTTCSEEEE
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCcCEEEEEECCCCcc-hhhHHHHHhhcCCCCEEEEeecCCHHHHHHHHhccCCCEEEE
Confidence            5899999999999999999999999999998765443 333333344456789999999999999999998  7999999


Q ss_pred             cCCCcc---------------hHHHHHHHHHHHHhcCCccEEEeccccccccCCCcc-------CCccchhhHhHhhhhH
Q 040431           83 TVGHTL---------------LADQVKIIAAIKEAEGASRGTLRTQKGKMSSLSSEM-------TTTLDMLEMTELIDQK  140 (157)
Q Consensus        83 ~a~~~~---------------~~~~~~l~~~~~~~~~~~~~v~~Ss~~~~~~~~~~~-------~~~~~~~~~~~~~~~~  140 (157)
                      +|+...               +.++.++++++++.+ ++++|++||..+|+..+...       ..+..+|..+|...+.
T Consensus        80 lAa~~~~~~~~~~~~~~~~~Nv~gt~nlL~~~~~~~-v~~~i~~Ss~~vy~~~~~~~~~e~~~~~~p~~~Y~~sK~~~e~  158 (338)
T d1udca_          80 FAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAAN-VKNFIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQ  158 (338)
T ss_dssp             CCSCCCHHHHHHCHHHHHHHHHHHHHHHHHHHHHHT-CCEEEEEEEGGGGCSCCSSSBCTTSCCCCCSSHHHHHHHHHHH
T ss_pred             CCCccchhhHHhCHHHHHHhHHHHHHHHHHHHHHhC-CCEEEecCcceEEccccccccccccccCCCcchHHHHHhhhhH
Confidence            998754               667999999999998 89999999999986543221       3678899999999988


Q ss_pred             HHHHHHh
Q 040431          141 IFIYFWG  147 (157)
Q Consensus       141 ~~~~~~~  147 (157)
                      +...++.
T Consensus       159 ~~~~~~~  165 (338)
T d1udca_         159 ILTDLQK  165 (338)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHh
Confidence            8665543



>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1xk7a1 c.123.1.1 (A:4-405) Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1x74a1 c.123.1.1 (A:2-360) 2-methylacyl-CoA racemase Mcr {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2vjma1 c.123.1.1 (A:2-428) Formyl-CoA transferase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ea_ c.123.1.1 (A:) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1qkia1 c.2.1.3 (A:12-199,A:435-449) Glucose 6-phosphate dehydrogenase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bula2 c.23.6.1 (A:741-896) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2j9ga2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h9aa1 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides [TaxId: 1245]} Back     information, alignment and structure
>d1jzta_ c.104.1.1 (A:) Hypothetical protein YNL200c (YNU0_YEAST) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1rtta_ c.23.5.4 (A:) Hypothetical protein PA1204 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure