Citrus Sinensis ID: 040474

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280---
MTYNFIRPDLIVGSCLQTPEDVDKLRQIGVKTIFCLQQDPDLEYFGVDIIAIQEYAKTYDDIQHIRAEIRDFDAFDLRMRLPAVISKLYKAINRNGGVTYVHCTAGLGRAPAVALAYMFWVLGYKLNEAHQLLLSKRPCFPKLDAIKSATADILTGLRKELVTFSWKGKNCTSVEISGIDIGWGQRMPLTFDKEQGLWILKRELPEGRYEYKYIVDGEWTCNKYELVSSPNKDGHVNNYVQVDDAPSSVSEALRNRLTSDDFDLTKDELHKIRAFLEACPDYE
cccccccccEEEcccccccccHHHHHHccccEEEEcccccccccccccHHHHHHHHHHccccEEEEEEcccccccHHHccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHcccccccccHHHHHHHHHHHHccHHHHHHHccccccccccccccccccccccccEEECccccEEEEEEEccccCEEEEEEEccEEEEccccccccccccccccEEEEEcccccccHHHHHHHHccccccccHHHHHHHHHHHHcccccc
MTYNFIRPDLIVGSCLQTPEDVDKLRQIGVKTIFCLQQDPDLEYFGVDIIAIQEYAKTYDDIQHIRAEIRDFDAFDLRMRLPAVISKLYKAINRNGGVTYVHCTAGLGRAPAVALAYMFWVLGYKLNEAHQLLLSKRPCFPKLDAIKSATADILTGLRKELVTFSWKGKNCTSVEISGIDIGWGQRMPLTFDKEQGLWILKRELPEGRYEYKYIVDGEWTCNKYELVSSPNKDGHVNNYVQVDDAPSS*******************ELHKIRAFLE******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTYNFIRPDLIVGSCLQTPEDVDKLRQIGVKTIFCLQQDPDLEYFGVDIIAIQEYAKTYDDIQHIRAEIRDFDAFDLRMRLPAVISKLYKAINRNGGVTYVHCTAGLGRAPAVALAYMFWVLGYKLNEAHQLLLSKRPCFPKLDAIKSATADILTGLRKELVTFSWKGKNCTSVEISGIDIGWGQRMPLTFDKEQGLWILKRELPEGRYEYKYIVDGEWTCNKYELVSSPNKDGHVNNYVQVDDAPSSVSEALRNRLTSDDFDLTKDELHKIRAFLEACPDYE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphoglucan phosphatase DSP4, chloroplastic Starch granule-associated phosphoglucan phosphatase involved in the control of starch accumulation. Acts as major regulator of the initial steps of starch degradation at the granule surface. Functions during the day by dephosphorylating the night-accumulated phospho-oligosaccharides. Can release phosphate from both the C6 and the C3 positions.probableQ9FEB5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NME, chain A
Confidence level:very confident
Coverage over the Query: 2-283
View the alignment between query and template
View the model in PyMOL