Citrus Sinensis ID: 040474
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 283 | ||||||
| 356535523 | 371 | PREDICTED: uncharacterized protein LOC10 | 0.992 | 0.757 | 0.814 | 1e-135 | |
| 255647912 | 371 | unknown [Glycine max] | 0.992 | 0.757 | 0.811 | 1e-134 | |
| 388503936 | 382 | unknown [Lotus japonicus] | 0.992 | 0.735 | 0.800 | 1e-133 | |
| 356576349 | 371 | PREDICTED: uncharacterized protein LOC10 | 0.992 | 0.757 | 0.807 | 1e-133 | |
| 52352665 | 375 | dual protein phosphatase 4 [Castanea sat | 1.0 | 0.754 | 0.795 | 1e-130 | |
| 225448873 | 378 | PREDICTED: uncharacterized protein LOC10 | 0.992 | 0.743 | 0.791 | 1e-129 | |
| 147820654 | 378 | hypothetical protein VITISV_036073 [Viti | 0.985 | 0.738 | 0.797 | 1e-128 | |
| 255584370 | 369 | phosphoprotein phosphatase, putative [Ri | 1.0 | 0.766 | 0.774 | 1e-126 | |
| 388492766 | 385 | unknown [Medicago truncatula] | 0.992 | 0.729 | 0.768 | 1e-125 | |
| 449449391 | 380 | PREDICTED: phosphoglucan phosphatase DSP | 0.992 | 0.739 | 0.727 | 1e-123 |
| >gi|356535523|ref|XP_003536294.1| PREDICTED: uncharacterized protein LOC100786287 [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 485 bits (1249), Expect = e-135, Method: Compositional matrix adjust.
Identities = 229/281 (81%), Positives = 251/281 (89%)
Query: 1 MTYNFIRPDLIVGSCLQTPEDVDKLRQIGVKTIFCLQQDPDLEYFGVDIIAIQEYAKTYD 60
M YNFIRPDLIVGSCLQTPEDVDKLR+IGVKTIFCLQQD DLEYFGVDI AI+EYAKT +
Sbjct: 89 MNYNFIRPDLIVGSCLQTPEDVDKLRRIGVKTIFCLQQDSDLEYFGVDINAIREYAKTCN 148
Query: 61 DIQHIRAEIRDFDAFDLRMRLPAVISKLYKAINRNGGVTYVHCTAGLGRAPAVALAYMFW 120
DIQH+RAEIRDFDAFDLR RLPAV+SKLYKAIN NGGVTY+HCTAGLGRAPAVALAYMFW
Sbjct: 149 DIQHLRAEIRDFDAFDLRRRLPAVVSKLYKAINSNGGVTYIHCTAGLGRAPAVALAYMFW 208
Query: 121 VLGYKLNEAHQLLLSKRPCFPKLDAIKSATADILTGLRKELVTFSWKGKNCTSVEISGID 180
VLGYKLNEAH LL SKR CFPKLDAIKSATADILTGL K+ VT SW+ KNC++VEISG+D
Sbjct: 209 VLGYKLNEAHTLLQSKRSCFPKLDAIKSATADILTGLSKKSVTLSWEDKNCSTVEISGLD 268
Query: 181 IGWGQRMPLTFDKEQGLWILKRELPEGRYEYKYIVDGEWTCNKYELVSSPNKDGHVNNYV 240
IGWGQR+PL FD ++GLW LKRELPEG YEYKYIVDGEWTCN EL++SPNKDGHVNN++
Sbjct: 269 IGWGQRIPLNFDDKEGLWFLKRELPEGLYEYKYIVDGEWTCNSDELITSPNKDGHVNNFI 328
Query: 241 QVDDAPSSVSEALRNRLTSDDFDLTKDELHKIRAFLEACPD 281
QV D SSV +LR RLT+DD DLT DE +I+ FLEACPD
Sbjct: 329 QVLDDTSSVRASLRKRLTADDPDLTTDEQLRIKEFLEACPD 369
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255647912|gb|ACU24414.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388503936|gb|AFK40034.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|356576349|ref|XP_003556295.1| PREDICTED: uncharacterized protein LOC100804010 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|52352665|gb|AAU43782.1| dual protein phosphatase 4 [Castanea sativa] | Back alignment and taxonomy information |
|---|
| >gi|225448873|ref|XP_002263116.1| PREDICTED: uncharacterized protein LOC100246216 [Vitis vinifera] gi|296083472|emb|CBI23430.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147820654|emb|CAN65362.1| hypothetical protein VITISV_036073 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255584370|ref|XP_002532919.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223527312|gb|EEF29461.1| phosphoprotein phosphatase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|388492766|gb|AFK34449.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449449391|ref|XP_004142448.1| PREDICTED: phosphoglucan phosphatase DSP4, chloroplastic-like [Cucumis sativus] gi|449513216|ref|XP_004164264.1| PREDICTED: phosphoglucan phosphatase DSP4, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 283 | ||||||
| TAIR|locus:2083845 | 379 | SEX4 "STARCH-EXCESS 4" [Arabid | 1.0 | 0.746 | 0.724 | 2.6e-111 | |
| UNIPROTKB|A8J2N4 | 428 | DSP8 "Dual specificity protein | 0.964 | 0.637 | 0.452 | 1.5e-60 | |
| TAIR|locus:2085542 | 282 | LSF2 "LIKE SEX4 2" [Arabidopsi | 0.537 | 0.539 | 0.480 | 6.7e-33 | |
| UNIPROTKB|Q2RBF6 | 271 | Os11g0113100 "cDNA clone:J0231 | 0.537 | 0.560 | 0.5 | 2.9e-32 | |
| UNIPROTKB|Q2QYN1 | 271 | LOC_Os12g02120 "Dual specifici | 0.537 | 0.560 | 0.493 | 4.7e-32 | |
| TAIR|locus:2084133 | 591 | LSF1 "AT3G01510" [Arabidopsis | 0.840 | 0.402 | 0.305 | 1.5e-26 | |
| UNIPROTKB|A8J1L0 | 204 | DSP6 "Dual-specificity protein | 0.526 | 0.730 | 0.421 | 2.2e-25 | |
| ZFIN|ZDB-GENE-030131-7172 | 260 | prkab1b "protein kinase, AMP-a | 0.353 | 0.384 | 0.346 | 4e-09 | |
| UNIPROTKB|E2QVF7 | 193 | E2QVF7 "Uncharacterized protei | 0.533 | 0.782 | 0.269 | 9e-09 | |
| UNIPROTKB|Q22X01 | 480 | TTHERM_00633520 "Dual specific | 0.462 | 0.272 | 0.285 | 1.2e-08 |
| TAIR|locus:2083845 SEX4 "STARCH-EXCESS 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1099 (391.9 bits), Expect = 2.6e-111, P = 2.6e-111
Identities = 205/283 (72%), Positives = 234/283 (82%)
Query: 1 MTYNFIRPDLIVGSCLQTPEDVDKLRQIGVKTIFCLQQDPDLEYFGVDIIAIQEYAKTYD 60
M YNFIRPDLIVGSCLQTPEDVDKLR+IGVKTIFCLQQDPDLEYFGVDI +IQ YAK Y
Sbjct: 96 MNYNFIRPDLIVGSCLQTPEDVDKLRKIGVKTIFCLQQDPDLEYFGVDISSIQAYAKKYS 155
Query: 61 DIQHIRAEIRDFDAFDLRMRLPAVISKLYKAINRNGGVTYVHCTAGLGRAPAVALAYMFW 120
DIQHIR EIRDFDAFDLRMRLPAV+ LYKA+ RNGGVTYVHCTAG+GRAPAVAL YMFW
Sbjct: 156 DIQHIRCEIRDFDAFDLRMRLPAVVGTLYKAVKRNGGVTYVHCTAGMGRAPAVALTYMFW 215
Query: 121 VLGYKLNEAHQLLLSKRPCFPKLDAIKSATADILTGLRKELVTFSWKGKNCTSVEISGID 180
V GYKL EAH+LL+SKR CFPKLDAI++AT DILTGL+++ VT + K K + VEISG+D
Sbjct: 216 VQGYKLMEAHKLLMSKRSCFPKLDAIRNATIDILTGLKRKTVTLTLKDKGFSRVEISGLD 275
Query: 181 IGWGQRMPLTFDKEQGLWILKRELPEGRYEYKYIVDGEWTCNKYELVSSPNKDGHVNNYV 240
IGWGQR+PLT DK G WILKRELPEG++EYKYI+DGEWT N+ E PNKDGH NNY
Sbjct: 276 IGWGQRIPLTLDKGTGFWILKRELPEGQFEYKYIIDGEWTHNEAEPFIGPNKDGHTNNYA 335
Query: 241 QVDDAPSSVSEALRNRLTSDDFDLTKDELHKIRAFLEACPDYE 283
+V D P+SV R RL+S+D +L ++E K+ FLE C + E
Sbjct: 336 KVVDDPTSVDGTTRERLSSEDPELLEEERSKLIQFLETCSEAE 378
|
|
| UNIPROTKB|A8J2N4 DSP8 "Dual specificity protein phosphatase 8" [Chlamydomonas reinhardtii (taxid:3055)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2085542 LSF2 "LIKE SEX4 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2RBF6 Os11g0113100 "cDNA clone:J023127J23, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2QYN1 LOC_Os12g02120 "Dual specificity phosphatase, catalytic domain containing protein, expressed" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2084133 LSF1 "AT3G01510" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8J1L0 DSP6 "Dual-specificity protein phosphatase 6" [Chlamydomonas reinhardtii (taxid:3055)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-7172 prkab1b "protein kinase, AMP-activated, beta 1 non-catalytic subunit, b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QVF7 E2QVF7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q22X01 TTHERM_00633520 "Dual specificity phosphatase, catalytic domain containing protein" [Tetrahymena thermophila SB210 (taxid:312017)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00018076001 | SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (378 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00019399001 | • | • | 0.551 | ||||||||
| GSVIVG00002767001 | • | • | 0.535 | ||||||||
| GSVIVG00033526001 | • | • | 0.471 | ||||||||
| GSVIVG00023316001 | • | • | 0.416 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 283 | |||
| cd02859 | 80 | cd02859, E_set_AMPKbeta_like_N, N-terminal Early s | 4e-23 | |
| pfam00782 | 131 | pfam00782, DSPc, Dual specificity phosphatase, cat | 4e-14 | |
| smart00195 | 138 | smart00195, DSPc, Dual specificity phosphatase, ca | 2e-13 | |
| cd00127 | 139 | cd00127, DSPc, Dual specificity phosphatases (DSP) | 1e-12 | |
| cd02688 | 82 | cd02688, E_set, Early set domain associated with t | 1e-08 | |
| COG2453 | 180 | COG2453, CDC14, Predicted protein-tyrosine phospha | 1e-06 | |
| pfam13350 | 163 | pfam13350, Y_phosphatase3, Tyrosine phosphatase fa | 2e-05 | |
| cd11294 | 83 | cd11294, E_set_Esterase_like_N, N-terminal Early s | 2e-04 | |
| COG2365 | 249 | COG2365, COG2365, Protein tyrosine/serine phosphat | 0.004 |
| >gnl|CDD|199889 cd02859, E_set_AMPKbeta_like_N, N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit | Back alignment and domain information |
|---|
Score = 90.0 bits (224), Expect = 4e-23
Identities = 32/81 (39%), Positives = 46/81 (56%), Gaps = 2/81 (2%)
Query: 162 VTFSWKGKNCTSVEISGIDIGWGQRMPLTFDKEQGLWILKRELPEGRYEYKYIVDGEWTC 221
VTF W G V ++G W Q +PL G + ELP GRYEYK+IVDGEW
Sbjct: 2 VTFRWPGPGGKEVYVTGSFDNWQQPIPLEKS-GDGEFSATVELPPGRYEYKFIVDGEWVH 60
Query: 222 NKYELVSSPNKDGHVNNYVQV 242
+ +L + ++ G++NN ++V
Sbjct: 61 DP-DLPTVTDEFGNLNNVLEV 80
|
E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase. Length = 80 |
| >gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >gnl|CDD|199878 cd02688, E_set, Early set domain associated with the catalytic domain of sugar utilizing enzymes at either the N or C terminus | Back alignment and domain information |
|---|
| >gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|222063 pfam13350, Y_phosphatase3, Tyrosine phosphatase family | Back alignment and domain information |
|---|
| >gnl|CDD|199894 cd11294, E_set_Esterase_like_N, N-terminal Early set domain associated with the catalytic domain of putative esterases | Back alignment and domain information |
|---|
| >gnl|CDD|225240 COG2365, COG2365, Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 283 | |||
| KOG1718 | 198 | consensus Dual specificity phosphatase [Defense me | 100.0 | |
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 99.97 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 99.95 | |
| KOG1717 | 343 | consensus Dual specificity phosphatase [Defense me | 99.95 | |
| KOG1716 | 285 | consensus Dual specificity phosphatase [Defense me | 99.95 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 99.95 | |
| PRK12361 | 547 | hypothetical protein; Provisional | 99.91 | |
| cd02859 | 79 | AMPKbeta_GBD_like AMP-activated protein kinase (AM | 99.91 | |
| KOG1719 | 183 | consensus Dual specificity phosphatase [Defense me | 99.91 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 99.89 | |
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 99.85 | |
| cd02861 | 82 | E_set_proteins_like E or "early" set-like proteins | 99.82 | |
| KOG1720 | 225 | consensus Protein tyrosine phosphatase CDC14 [Defe | 99.82 | |
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 99.76 | |
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 99.74 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 99.67 | |
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 99.66 | |
| KOG1616 | 289 | consensus Protein involved in Snf1 protein kinase | 99.63 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 99.62 | |
| KOG2836 | 173 | consensus Protein tyrosine phosphatase IVA1 [Signa | 99.53 | |
| COG3453 | 130 | Uncharacterized protein conserved in bacteria [Fun | 99.52 | |
| PLN02727 | 986 | NAD kinase | 99.41 | |
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 99.25 | |
| cd02858 | 85 | Esterase_N_term Esterase N-terminal domain. Estera | 99.19 | |
| KOG1572 | 249 | consensus Predicted protein tyrosine phosphatase [ | 99.19 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 99.18 | |
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 99.18 | |
| KOG2283 | 434 | consensus Clathrin coat dissociation kinase GAK/PT | 99.06 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 98.96 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 98.86 | |
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 98.76 | |
| cd02688 | 83 | E_set E or "early" set of sugar utilizing enzymes | 98.76 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 98.61 | |
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 98.55 | |
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 98.52 | |
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 98.42 | |
| PF02922 | 85 | CBM_48: Carbohydrate-binding module 48 (Isoamylase | 98.41 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 98.4 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 98.4 | |
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 98.39 | |
| cd02854 | 99 | Glycogen_branching_enzyme_like_N_term Glycogen bra | 98.38 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 98.33 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 98.23 | |
| PF04179 | 451 | Init_tRNA_PT: Initiator tRNA phosphoribosyl transf | 98.0 | |
| KOG0792 | 1144 | consensus Protein tyrosine phosphatase PTPMEG, con | 98.0 | |
| KOG2386 | 393 | consensus mRNA capping enzyme, guanylyltransferase | 97.91 | |
| KOG0790 | 600 | consensus Protein tyrosine phosphatase Corkscrew a | 97.9 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 97.85 | |
| KOG0791 | 374 | consensus Protein tyrosine phosphatase, contains f | 97.74 | |
| cd02855 | 106 | Glycogen_branching_enzyme_N_term Glycogen branchin | 97.54 | |
| cd02860 | 100 | Pullulanase_N_term Pullulanase domain N-terminus. | 97.43 | |
| COG0296 | 628 | GlgB 1,4-alpha-glucan branching enzyme [Carbohydra | 97.43 | |
| KOG0789 | 415 | consensus Protein tyrosine phosphatase [Signal tra | 97.41 | |
| cd05814 | 120 | CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate- | 97.39 | |
| PRK12568 | 730 | glycogen branching enzyme; Provisional | 97.08 | |
| cd02856 | 103 | Glycogen_debranching_enzyme_N_term Glycogen_debran | 96.98 | |
| PF00686 | 96 | CBM_20: Starch binding domain; InterPro: IPR002044 | 96.9 | |
| PRK14705 | 1224 | glycogen branching enzyme; Provisional | 96.85 | |
| PRK12313 | 633 | glycogen branching enzyme; Provisional | 96.85 | |
| cd05808 | 95 | CBM20_alpha_amylase Alpha-amylase, C-terminal CBM2 | 96.82 | |
| cd02852 | 119 | Isoamylase_N_term Isoamylase N-terminus domain. Is | 96.79 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 96.79 | |
| KOG0793 | 1004 | consensus Protein tyrosine phosphatase [Signal tra | 96.69 | |
| cd05809 | 99 | CBM20_beta_amylase Beta-amylase, C-terminal CBM20 | 96.65 | |
| PRK14706 | 639 | glycogen branching enzyme; Provisional | 96.6 | |
| cd02853 | 85 | MTHase_N_term Maltooligosyl trehalose synthase (MT | 96.54 | |
| cd05816 | 99 | CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DP | 96.46 | |
| TIGR02402 | 542 | trehalose_TreZ malto-oligosyltrehalose trehalohydr | 96.42 | |
| PLN02447 | 758 | 1,4-alpha-glucan-branching enzyme | 96.34 | |
| PF14671 | 141 | DSPn: Dual specificity protein phosphatase, N-term | 96.26 | |
| PF11806 | 122 | DUF3327: Domain of unknown function (DUF3327); Int | 96.11 | |
| KOG4228 | 1087 | consensus Protein tyrosine phosphatase [Signal tra | 96.11 | |
| cd05820 | 103 | CBM20_novamyl Novamyl (also known as acarviose tra | 95.94 | |
| TIGR01515 | 613 | branching_enzym alpha-1,4-glucan:alpha-1,4-glucan | 95.94 | |
| cd05818 | 92 | CBM20_water_dikinase Phosphoglucan water dikinase | 95.89 | |
| cd05813 | 95 | CBM20_genethonin_1 Genethonin-1, C-terminal CBM20 | 95.84 | |
| cd05817 | 100 | CBM20_DSP Dual-specificity phosphatase (DSP), N-te | 95.57 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 95.45 | |
| cd05467 | 96 | CBM20 The family 20 carbohydrate-binding module (C | 95.21 | |
| PRK10439 | 411 | enterobactin/ferric enterobactin esterase; Provisi | 95.18 | |
| cd05811 | 106 | CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-g | 94.98 | |
| KOG4228 | 1087 | consensus Protein tyrosine phosphatase [Signal tra | 94.96 | |
| cd05810 | 97 | CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrol | 94.75 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 94.72 | |
| PLN02160 | 136 | thiosulfate sulfurtransferase | 94.43 | |
| cd05806 | 112 | CBM20_laforin Laforin protein tyrosine phosphatase | 93.99 | |
| cd05815 | 101 | CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DP | 93.41 | |
| PF03423 | 87 | CBM_25: Carbohydrate binding domain (family 25); I | 93.39 | |
| cd05807 | 101 | CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrat | 93.08 | |
| PRK01415 | 247 | hypothetical protein; Validated | 92.57 | |
| KOG4471 | 717 | consensus Phosphatidylinositol 3-phosphate 3-phosp | 92.29 | |
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 92.29 | |
| TIGR02104 | 605 | pulA_typeI pullulanase, type I. Pullulan is an unu | 91.69 | |
| PLN02316 | 1036 | synthase/transferase | 89.54 | |
| PF06602 | 353 | Myotub-related: Myotubularin-like phosphatase doma | 88.86 | |
| cd01520 | 128 | RHOD_YbbB Member of the Rhodanese Homology Domain | 88.65 | |
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 88.02 | |
| TIGR02100 | 688 | glgX_debranch glycogen debranching enzyme GlgX. Th | 87.7 | |
| KOG1089 | 573 | consensus Myotubularin-related phosphatidylinosito | 87.62 | |
| PLN02950 | 909 | 4-alpha-glucanotransferase | 86.37 | |
| cd01533 | 109 | 4RHOD_Repeat_2 Member of the Rhodanese Homology Do | 86.25 | |
| TIGR02103 | 898 | pullul_strch alpha-1,6-glucosidases, pullulanase-t | 86.1 | |
| PLN02950 | 909 | 4-alpha-glucanotransferase | 85.99 | |
| cd02857 | 116 | CD_pullulan_degrading_enzymes_N_term CD and pullul | 85.53 | |
| PLN02316 | 1036 | synthase/transferase | 84.25 | |
| cd01522 | 117 | RHOD_1 Member of the Rhodanese Homology Domain sup | 83.66 | |
| PF00581 | 113 | Rhodanese: Rhodanese-like domain This Prosite entr | 83.45 | |
| smart00450 | 100 | RHOD Rhodanese Homology Domain. An alpha beta fold | 83.43 | |
| PLN02960 | 897 | alpha-amylase | 82.75 | |
| TIGR02102 | 1111 | pullulan_Gpos pullulanase, extracellular, Gram-pos | 82.32 | |
| PRK03705 | 658 | glycogen debranching enzyme; Provisional | 80.54 |
| >KOG1718 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.6e-32 Score=213.90 Aligned_cols=163 Identities=25% Similarity=0.363 Sum_probs=141.3
Q ss_pred cccccCCeEEcCCCCCcccHHHHHhcCCcEEEEcCcCCCCCccCCChHHHHHHhhhCCCeEEEEEeccCCCchhHhhhHH
Q 040474 3 YNFIRPDLIVGSCLQTPEDVDKLRQIGVKTIFCLQQDPDLEYFGVDIIAIQEYAKTYDDIQHIRAEIRDFDAFDLRMRLP 82 (283)
Q Consensus 3 ~~~I~~~l~lG~~p~~~~~~~~L~~~gI~~Vv~l~~~~e~~~~~~~~~~~~~~~~~~~~i~~~~ipi~D~~~~~~~~~~~ 82 (283)
+++|+|+||+++. ..+.+...|+++||++|||.+.+..... .++++|..+|+.|.+...+..+|+
T Consensus 17 ~SqIt~sLfl~~G-vaA~~k~~l~~~~It~IiNat~E~pn~~--------------l~~~qy~kv~~~D~p~~~l~~hfD 81 (198)
T KOG1718|consen 17 MSQITPSLFLSNG-VAANDKLLLKKRKITCIINATTEVPNTS--------------LPDIQYMKVPLEDTPQARLYDHFD 81 (198)
T ss_pred hhhcCcceeEecc-ccccCHHHHHhcCceEEEEcccCCCCcc--------------CCCceeEEEEcccCCcchhhhhhh
Confidence 6899999999965 4788999999999999999998764311 257999999999999999999999
Q ss_pred HHHHHHHHHHHcCCCEEEEEcCCCCChhHHHHHHHHHHHhCCCHHHHHHHHHhhCCCC-CChhHHHHhHHhhhhccccce
Q 040474 83 AVISKLYKAINRNGGVTYVHCTAGLGRAPAVALAYMFWVLGYKLNEAHQLLLSKRPCF-PKLDAIKSATADILTGLRKEL 161 (283)
Q Consensus 83 ~~~~~i~~~l~~~~~~VlVHC~~G~~RS~~v~~ayLm~~~~~~~~~A~~~v~~~r~~~-pn~~~~~~~~~~~~~~~~~~~ 161 (283)
.+.+.|+... .+||++||||.||+|||+++|+||||++.+|++.||+.++|++||.+ ||-||++| +
T Consensus 82 ~vAD~I~~v~-~~gG~TLvHC~AGVSRSAsLClAYLmK~~~msLreAy~~vKa~RpiIRPN~GFw~Q------------L 148 (198)
T KOG1718|consen 82 PVADKIHSVI-MRGGKTLVHCVAGVSRSASLCLAYLMKYHCMSLREAYHWVKARRPIIRPNVGFWRQ------------L 148 (198)
T ss_pred HHHHHHHHHH-hcCCcEEEEEccccchhHHHHHHHHHHHccchHHHHHHHHHhhCceeCCCccHHHH------------H
Confidence 9999998875 67899999999999999999999999999999999999999999998 88877775 4
Q ss_pred EEEEeeCCCcceEEEeeccCCCCccccceeecC
Q 040474 162 VTFSWKGKNCTSVEISGIDIGWGQRMPLTFDKE 194 (283)
Q Consensus 162 v~f~w~~~g~~~v~l~Gsf~~W~~~~pl~~~~~ 194 (283)
+.++.+..|..+|.++.+-.+= +.+|..+.++
T Consensus 149 i~YE~qL~g~~sV~MV~~p~~d-~~iPDvye~e 180 (198)
T KOG1718|consen 149 IDYEQQLFGNASVRMVQTPVGD-QLIPDVYEKE 180 (198)
T ss_pred HHHHHHhcCCCeEEEEeccccC-ccCchhhccc
Confidence 4455556888899999987663 5788888754
|
|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1716 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02859 AMPKbeta_GBD_like AMP-activated protein kinase (AMPK) beta subunit glycogen binding domain (GBD) | Back alignment and domain information |
|---|
| >KOG1719 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd02861 E_set_proteins_like E or "early" set-like proteins | Back alignment and domain information |
|---|
| >KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1616 consensus Protein involved in Snf1 protein kinase complex assembly [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3453 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >cd02858 Esterase_N_term Esterase N-terminal domain | Back alignment and domain information |
|---|
| >KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02688 E_set E or "early" set of sugar utilizing enzymes which may be related to the immunoglobulin and/or fibronectin type III superfamilies | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF02922 CBM_48: Carbohydrate-binding module 48 (Isoamylase N-terminal domain); InterPro: IPR004193 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >cd02854 Glycogen_branching_enzyme_like_N_term Glycogen branching enzyme-like N-terminus domain | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 | Back alignment and domain information |
|---|
| >KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02855 Glycogen_branching_enzyme_N_term Glycogen branching enzyme N-terminus domain | Back alignment and domain information |
|---|
| >cd02860 Pullulanase_N_term Pullulanase domain N-terminus | Back alignment and domain information |
|---|
| >COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05814 CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PRK12568 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd02856 Glycogen_debranching_enzyme_N_term Glycogen_debranching_enzyme N-terminal domain | Back alignment and domain information |
|---|
| >PF00686 CBM_20: Starch binding domain; InterPro: IPR002044 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK14705 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK12313 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd05808 CBM20_alpha_amylase Alpha-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd02852 Isoamylase_N_term Isoamylase N-terminus domain | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05809 CBM20_beta_amylase Beta-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PRK14706 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd02853 MTHase_N_term Maltooligosyl trehalose synthase (MTSase) N-terminus domain | Back alignment and domain information |
|---|
| >cd05816 CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 2 | Back alignment and domain information |
|---|
| >TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase | Back alignment and domain information |
|---|
| >PLN02447 1,4-alpha-glucan-branching enzyme | Back alignment and domain information |
|---|
| >PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A | Back alignment and domain information |
|---|
| >PF11806 DUF3327: Domain of unknown function (DUF3327); InterPro: IPR021764 This entry represents the N-terminal domain of enterochelin esterase | Back alignment and domain information |
|---|
| >KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05820 CBM20_novamyl Novamyl (also known as acarviose transferase, ATase, maltogenic alpha-amylase, glucan 1,4-alpha-maltohydrolase, and AcbD), C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase | Back alignment and domain information |
|---|
| >cd05818 CBM20_water_dikinase Phosphoglucan water dikinase (also known as alpha-glucan water dikinase), N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05813 CBM20_genethonin_1 Genethonin-1, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05817 CBM20_DSP Dual-specificity phosphatase (DSP), N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >cd05467 CBM20 The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase) | Back alignment and domain information |
|---|
| >PRK10439 enterobactin/ferric enterobactin esterase; Provisional | Back alignment and domain information |
|---|
| >cd05811 CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05810 CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrolase (alpha-MTH), C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
| >cd05806 CBM20_laforin Laforin protein tyrosine phosphatase, N-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >cd05815 CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 1 | Back alignment and domain information |
|---|
| >PF03423 CBM_25: Carbohydrate binding domain (family 25); InterPro: IPR005085 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity | Back alignment and domain information |
|---|
| >cd05807 CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG4471 consensus Phosphatidylinositol 3-phosphate 3-phosphatase myotubularin MTM1 [Lipid transport and metabolism; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02104 pulA_typeI pullulanase, type I | Back alignment and domain information |
|---|
| >PLN02316 synthase/transferase | Back alignment and domain information |
|---|
| >PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO | Back alignment and domain information |
|---|
| >cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >TIGR02100 glgX_debranch glycogen debranching enzyme GlgX | Back alignment and domain information |
|---|
| >KOG1089 consensus Myotubularin-related phosphatidylinositol 3-phosphate 3-phosphatase MTM6 [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02950 4-alpha-glucanotransferase | Back alignment and domain information |
|---|
| >cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 | Back alignment and domain information |
|---|
| >TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type | Back alignment and domain information |
|---|
| >PLN02950 4-alpha-glucanotransferase | Back alignment and domain information |
|---|
| >cd02857 CD_pullulan_degrading_enzymes_N_term CD and pullulan-degrading enzymes N-terminus domain | Back alignment and domain information |
|---|
| >PLN02316 synthase/transferase | Back alignment and domain information |
|---|
| >cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family | Back alignment and domain information |
|---|
| >smart00450 RHOD Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >PLN02960 alpha-amylase | Back alignment and domain information |
|---|
| >TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive | Back alignment and domain information |
|---|
| >PRK03705 glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 283 | ||||
| 3nme_A | 294 | Structure Of A Plant Phosphatase Length = 294 | 1e-118 | ||
| 3lj8_A | 146 | Crystal Structure Of Mkp-4 Length = 146 | 9e-06 | ||
| 1z0m_A | 96 | The Glycogen-Binding Domain Of The Amp-Activated Pr | 1e-05 | ||
| 1z0n_A | 96 | The Glycogen-Binding Domain Of The Amp-Activated Pr | 5e-05 | ||
| 2hcm_A | 164 | Crystal Structure Of Mouse Putative Dual Specificit | 9e-05 | ||
| 2hxp_A | 155 | Crystal Structure Of The Human Phosphatase (Dusp9) | 1e-04 | ||
| 2f15_A | 96 | Glycogen-Binding Domain Of The Amp-Activated Protei | 1e-04 | ||
| 1mkp_A | 144 | Crystal Structure Of Pyst1 (Mkp3) Length = 144 | 4e-04 | ||
| 2e0t_A | 151 | Crystal Structure Of Catalytic Domain Of Dual Speci | 4e-04 |
| >pdb|3NME|A Chain A, Structure Of A Plant Phosphatase Length = 294 | Back alignment and structure |
|
| >pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 | Back alignment and structure |
| >pdb|1Z0M|A Chain A, The Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Beta1 Subunit Length = 96 | Back alignment and structure |
| >pdb|1Z0N|A Chain A, The Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Length = 96 | Back alignment and structure |
| >pdb|2HCM|A Chain A, Crystal Structure Of Mouse Putative Dual Specificity Phosphatase Complexed With Zinc Tungstate, New York Structural Genomics Consortium Length = 164 | Back alignment and structure |
| >pdb|2HXP|A Chain A, Crystal Structure Of The Human Phosphatase (Dusp9) Length = 155 | Back alignment and structure |
| >pdb|2F15|A Chain A, Glycogen-Binding Domain Of The Amp-Activated Protein Kinase Beta2 Subunit Length = 96 | Back alignment and structure |
| >pdb|1MKP|A Chain A, Crystal Structure Of Pyst1 (Mkp3) Length = 144 | Back alignment and structure |
| >pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 283 | |||
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 1e-101 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 4e-24 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 4e-20 | |
| 2qlv_B | 252 | Protein SIP2, protein SPM2; heterotrimer, ATP-bind | 2e-19 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 6e-19 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 6e-19 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 6e-18 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 9e-18 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 3e-17 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 3e-17 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 3e-17 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 3e-17 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 8e-17 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 1e-16 | |
| 1z0n_A | 96 | 5'-AMP-activated protein kinase, beta-1 subunit; b | 2e-16 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 3e-16 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 4e-16 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 5e-16 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 6e-16 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 9e-16 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 1e-15 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 1e-15 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 2e-15 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 4e-15 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 2e-13 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 3e-12 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 3e-12 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 8e-12 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 9e-12 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 1e-11 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 1e-11 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 7e-11 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 8e-07 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 7e-06 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 1e-05 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 1e-05 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 2e-05 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 2e-05 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 5e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-04 |
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 | Back alignment and structure |
|---|
Score = 295 bits (757), Expect = e-101
Identities = 203/283 (71%), Positives = 232/283 (81%)
Query: 1 MTYNFIRPDLIVGSCLQTPEDVDKLRQIGVKTIFCLQQDPDLEYFGVDIIAIQEYAKTYD 60
M YNFIRPDLIVGSCLQTPEDVDKLR+IGVKTIFCLQQDPDLEYFGVDI +IQ YAK Y
Sbjct: 11 MNYNFIRPDLIVGSCLQTPEDVDKLRKIGVKTIFCLQQDPDLEYFGVDISSIQAYAKKYS 70
Query: 61 DIQHIRAEIRDFDAFDLRMRLPAVISKLYKAINRNGGVTYVHCTAGLGRAPAVALAYMFW 120
DIQHIR EIRDFDAFDLRMRLPAV+ LYKA+ RNGGVTYVH TAG+GRAPAVAL YMFW
Sbjct: 71 DIQHIRCEIRDFDAFDLRMRLPAVVGTLYKAVKRNGGVTYVHSTAGMGRAPAVALTYMFW 130
Query: 121 VLGYKLNEAHQLLLSKRPCFPKLDAIKSATADILTGLRKELVTFSWKGKNCTSVEISGID 180
V GYKL EAH+LL+SKR CFPKLDAI++AT DILTGL+++ VT + K K + VEISG+D
Sbjct: 131 VQGYKLMEAHKLLMSKRSCFPKLDAIRNATIDILTGLKRKTVTLTLKDKGFSRVEISGLD 190
Query: 181 IGWGQRMPLTFDKEQGLWILKRELPEGRYEYKYIVDGEWTCNKYELVSSPNKDGHVNNYV 240
IGWGQR+PLT K G WILKRELPEG++EYKYI+DGEWT N+ E PNKDGH NNY
Sbjct: 191 IGWGQRIPLTLGKGTGFWILKRELPEGQFEYKYIIDGEWTHNEAEPFIGPNKDGHTNNYA 250
Query: 241 QVDDAPSSVSEALRNRLTSDDFDLTKDELHKIRAFLEACPDYE 283
+V D P+SV R RL+S+D +L ++E K+ FLE C + E
Sbjct: 251 KVVDDPTSVDGTTRERLSSEDPELLEEERSKLIQFLETCSEAE 293
|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >2qlv_B Protein SIP2, protein SPM2; heterotrimer, ATP-binding, carbohydrate metabolism, kinase, membrane, nucleotide-binding, nucleus; 2.60A {Saccharomyces cerevisiae} SCOP: b.1.18.21 d.353.1.1 Length = 252 | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >1z0n_A 5'-AMP-activated protein kinase, beta-1 subunit; beta sandwich, sugar binding protein; HET: BCD; 1.49A {Rattus norvegicus} SCOP: b.1.18.21 PDB: 1z0m_A* 2f15_A Length = 96 | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Length = 151 | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Length = 156 | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Length = 339 | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Length = 157 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 283 | |||
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 100.0 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 100.0 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 99.98 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 99.97 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 99.97 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 99.97 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 99.97 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 99.97 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 99.97 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 99.97 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 99.97 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 99.97 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 99.96 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 99.96 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 99.96 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 99.96 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 99.96 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 99.96 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 99.96 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 99.96 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 99.95 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 99.95 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 99.94 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 99.94 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 99.92 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 99.91 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 99.89 | |
| 1z0n_A | 96 | 5'-AMP-activated protein kinase, beta-1 subunit; b | 99.89 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 99.89 | |
| 2qlv_B | 252 | Protein SIP2, protein SPM2; heterotrimer, ATP-bind | 99.87 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 99.85 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 99.84 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.84 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.83 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 99.82 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.8 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 99.79 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 99.76 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 99.69 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 99.59 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 99.58 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 99.55 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 99.34 | |
| 4aef_A | 645 | Neopullulanase (alpha-amylase II); hydrolase, ther | 99.15 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 99.14 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 98.93 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 98.92 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 98.91 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 98.89 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 98.88 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 98.87 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 98.86 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 98.86 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 98.84 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 98.83 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 98.83 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 98.83 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 98.83 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 98.83 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 98.82 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 98.82 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 98.81 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 98.81 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 98.79 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 98.77 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 98.74 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 98.74 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 98.73 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 98.72 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 98.71 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 98.7 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 98.68 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 98.63 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 98.62 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 98.56 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 98.56 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 98.49 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 98.48 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 98.48 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 98.47 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 98.47 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 98.47 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 98.44 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 98.44 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 98.38 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 98.36 | |
| 3c8d_A | 403 | Enterochelin esterase; alpha-beta-alpha sandwich, | 98.34 | |
| 2z0b_A | 131 | GDE5, KIAA1434, putative glycerophosphodiester pho | 98.3 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 98.28 | |
| 1ac0_A | 108 | Glucoamylase; hydrolase, starch binding domain; HE | 97.66 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 97.61 | |
| 1m7x_A | 617 | 1,4-alpha-glucan branching enzyme; alpha/beta barr | 97.22 | |
| 3k1d_A | 722 | 1,4-alpha-glucan-branching enzyme; mycobacterium t | 96.98 | |
| 3aml_A | 755 | OS06G0726400 protein; starch-branching, transferas | 96.86 | |
| 2bhu_A | 602 | Maltooligosyltrehalose trehalohydrolase; alpha-amy | 95.37 | |
| 3vgf_A | 558 | Malto-oligosyltrehalose trehalohydrolase; alpha/be | 95.21 | |
| 2laa_A | 104 | Beta/alpha-amylase; SBD, CBM25, hydrolase; NMR {Pa | 95.02 | |
| 1bf2_A | 750 | Isoamylase; hydrolase, glycosidase, debranching en | 95.01 | |
| 2wsk_A | 657 | Glycogen debranching enzyme; carbohydrate metaboli | 94.8 | |
| 2vr5_A | 718 | Glycogen operon protein GLGX; hydrolase, glycosida | 94.56 | |
| 2fhf_A | 1083 | Pullulanase; multiple domain, beta-alpha-barrel, a | 93.69 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 93.46 | |
| 2vn4_A | 599 | Glucoamylase; hydrolase, carbohydrate binding, gly | 93.44 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 93.06 | |
| 2e8y_A | 718 | AMYX protein, pullulanase; multiple domain, beta-a | 92.83 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 92.5 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 92.29 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 92.17 | |
| 1vem_A | 516 | Beta-amylase; beta-alpha-barrels, optimum PH, hydr | 92.09 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 91.97 | |
| 3m07_A | 618 | Putative alpha amylase; IDP00968, csgid, structura | 91.3 | |
| 3faw_A | 877 | Reticulocyte binding protein; TIM barrel, beta bar | 89.92 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 89.2 | |
| 2ya0_A | 714 | Putative alkaline amylopullulanase; hydrolase, gly | 89.0 | |
| 2yf0_A | 512 | Myotubularin-related protein 6; hydrolase; 2.65A { | 87.37 | |
| 4aio_A | 884 | Limit dextrinase; hydrolase, pullulanase, glycosid | 87.1 | |
| 1ji1_A | 637 | Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 | 86.35 | |
| 1zsq_A | 528 | Myotubularin-related protein 2; protein-phospholip | 85.57 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 85.43 | |
| 1ea9_C | 583 | Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A | 84.95 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 84.16 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 83.85 | |
| 4fch_A | 221 | Outer membrane protein SUSE; starch binding, extra | 83.69 | |
| 1lw3_A | 657 | Myotubularin-related protein 2; protein-phosphate | 82.89 | |
| 2ya1_A | 1014 | Putative alkaline amylopullulanase; hydrolase, gly | 82.06 | |
| 3iwh_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 80.89 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 80.23 |
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Probab=100.00 E-value=3.1e-71 Score=491.89 Aligned_cols=283 Identities=72% Similarity=1.207 Sum_probs=265.8
Q ss_pred CccccccCCeEEcCCCCCcccHHHHHhcCCcEEEEcCcCCCCCccCCChHHHHHHhhhCCCeEEEEEeccCCCchhHhhh
Q 040474 1 MTYNFIRPDLIVGSCLQTPEDVDKLRQIGVKTIFCLQQDPDLEYFGVDIIAIQEYAKTYDDIQHIRAEIRDFDAFDLRMR 80 (283)
Q Consensus 1 m~~~~I~~~l~lG~~p~~~~~~~~L~~~gI~~Vv~l~~~~e~~~~~~~~~~~~~~~~~~~~i~~~~ipi~D~~~~~~~~~ 80 (283)
||+++|+|+||+|+++.++.+++.|+++||++||||+.+.+...++++...+.+.+....++.|+++|+.|...+++..+
T Consensus 11 ~n~s~I~p~LylGs~~~~~~d~~~L~~~GIt~Vlnl~~~~e~~~~g~~~~~~~~~~~~~~gi~~~~ipi~D~~~~~l~~~ 90 (294)
T 3nme_A 11 MNYNFIRPDLIVGSCLQTPEDVDKLRKIGVKTIFCLQQDPDLEYFGVDISSIQAYAKKYSDIQHIRCEIRDFDAFDLRMR 90 (294)
T ss_dssp CCEEEEETTEEEECCCCSTHHHHHHHHTTEEEEEECCCHHHHHHTTCCHHHHHHHHHTCTTCEEEECCCCTTCHHHHHHH
T ss_pred CCceEEeCCEEEEcCCCCHHHHHHHHHCCCCEEEECCCCcchhhccCChhhhhhhhhhcCCcEEEEEeCCCCCCCCHHHH
Confidence 78999999999999976789999999999999999998887767777777776666665579999999999999999889
Q ss_pred HHHHHHHHHHHHHcCCCEEEEEcCCCCChhHHHHHHHHHHHhCCCHHHHHHHHHhhCCCCCChhHHHHhHHhhhhccccc
Q 040474 81 LPAVISKLYKAINRNGGVTYVHCTAGLGRAPAVALAYMFWVLGYKLNEAHQLLLSKRPCFPKLDAIKSATADILTGLRKE 160 (283)
Q Consensus 81 ~~~~~~~i~~~l~~~~~~VlVHC~~G~~RS~~v~~ayLm~~~~~~~~~A~~~v~~~r~~~pn~~~~~~~~~~~~~~~~~~ 160 (283)
|.+++++|++++++++++|||||.+|+|||+++++||||+..||++++|+++|+++||+.||.++++++|++++.++.++
T Consensus 91 ~~~~~~~I~~~l~~~g~~VLVHC~aG~sRS~tvv~ayLm~~~g~s~~~A~~~v~~~Rp~~Pn~~~l~~~~~~~L~~~~k~ 170 (294)
T 3nme_A 91 LPAVVGTLYKAVKRNGGVTYVHSTAGMGRAPAVALTYMFWVQGYKLMEAHKLLMSKRSCFPKLDAIRNATIDILTGLKRK 170 (294)
T ss_dssp HHHHHHHHHHHHHHHCSEEEEECSSSSSHHHHHHHHHHHHTSCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCE
T ss_pred HHHHHHHHHHHHHhCCCEEEEECCCCCchhHHHHHHHHHHHhCCCHHHHHHHHHHhCCCCCChhhhhHHHHHhhhccccc
Confidence 99999999999866688999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eEEEEeeCCCcceEEEeeccCCCCccccceeecCCCeEEEEEecCCceEEEEEEECCEeeecCCcceeecCCCCCcceEE
Q 040474 161 LVTFSWKGKNCTSVEISGIDIGWGQRMPLTFDKEQGLWILKRELPEGRYEYKYIVDGEWTCNKYELVSSPNKDGHVNNYV 240 (283)
Q Consensus 161 ~v~f~w~~~g~~~v~l~Gsf~~W~~~~pl~~~~~~~~~~~~~~l~~g~y~ykf~vdg~w~~d~~~~~~~~~~~G~~nn~i 240 (283)
+++|+|..+++++|+|+|||++|++++||.+.+.+|.|++++.||||+|+|||+|||+|++||++|.+.+|++|+.||+|
T Consensus 171 ~v~f~~~~~~~~~V~v~GsF~~W~~~~~l~k~~~~g~~~~~~~L~~G~y~YkFiVDG~w~~d~~~~~~~~d~~G~~nn~~ 250 (294)
T 3nme_A 171 TVTLTLKDKGFSRVEISGLDIGWGQRIPLTLGKGTGFWILKRELPEGQFEYKYIIDGEWTHNEAEPFIGPNKDGHTNNYA 250 (294)
T ss_dssp EEEEEEECSSCSCEEEEETTTEEEEEEECEECTTTCEEEEEEEECSEEEEEEEEETTEEECCTTSCEECSCTTSCCEEEE
T ss_pred cceeeeccCCCCEEEEEEeccCCCCcccceEcCCCCEEEEEEECCCceEEEEEEECCEEeeCCCCCeeeECCCCCEeEEE
Confidence 99999999878999999999999989999997668999999999999999999999999999999988779999999999
Q ss_pred EeccCCCcchHHHhhcccCCCCCCChHHHHHHHHHHhhCCCCC
Q 040474 241 QVDDAPSSVSEALRNRLTSDDFDLTKDELHKIRAFLEACPDYE 283 (283)
Q Consensus 241 ~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 283 (283)
.|.++++++.+++|+++++++++||+|||.+|+.+||++|+.|
T Consensus 251 ~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 293 (294)
T 3nme_A 251 KVVDDPTSVDGTTRERLSSEDPELLEEERSKLIQFLETCSEAE 293 (294)
T ss_dssp EECCCCCTTCTTHHHHHSSSSCCCCHHHHHHHHHHHHHHCCCC
T ss_pred EECCCCcchhHHHHHHhhcCCccccHHHHHHHHHHHHhccccc
Confidence 9999889999999999999999999999999999999999875
|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >1z0n_A 5'-AMP-activated protein kinase, beta-1 subunit; beta sandwich, sugar binding protein; HET: BCD; 1.49A {Rattus norvegicus} SCOP: b.1.18.21 PDB: 1z0m_A* 2f15_A | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >2qlv_B Protein SIP2, protein SPM2; heterotrimer, ATP-binding, carbohydrate metabolism, kinase, membrane, nucleotide-binding, nucleus; 2.60A {Saccharomyces cerevisiae} SCOP: b.1.18.21 d.353.1.1 | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* | Back alignment and structure |
|---|
| >2z0b_A GDE5, KIAA1434, putative glycerophosphodiester phosphodiesterase; CBM20 domain, starch-binding, hydrolase, STR genomics, NPPSFA; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1ac0_A Glucoamylase; hydrolase, starch binding domain; HET: GLC BGC GLO; NMR {Aspergillus niger} SCOP: b.3.1.1 PDB: 1acz_A* 1kul_A 1kum_A | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* | Back alignment and structure |
|---|
| >3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A | Back alignment and structure |
|---|
| >2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* | Back alignment and structure |
|---|
| >3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A | Back alignment and structure |
|---|
| >2laa_A Beta/alpha-amylase; SBD, CBM25, hydrolase; NMR {Paenibacillus polymyxa} PDB: 2lab_A | Back alignment and structure |
|---|
| >1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A | Back alignment and structure |
|---|
| >2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A | Back alignment and structure |
|---|
| >2vn4_A Glucoamylase; hydrolase, carbohydrate binding, glycoside hydrolase family 15, amyloglucosidase; HET: MAN NAG BTB; 1.85A {Hypocrea jecorina} PDB: 2vn7_A* | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A | Back alignment and structure |
|---|
| >2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* | Back alignment and structure |
|---|
| >1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* | Back alignment and structure |
|---|
| >3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* | Back alignment and structure |
|---|
| >2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A | Back alignment and structure |
|---|
| >1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A | Back alignment and structure |
|---|
| >1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >4fch_A Outer membrane protein SUSE; starch binding, extracellular, carbohydrate-B protein; HET: GLC; 1.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A | Back alignment and structure |
|---|
| >2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 283 | ||||
| d1vhra_ | 178 | c.45.1.1 (A:) VH1-related dual-specificity phospha | 4e-19 | |
| d1z0na1 | 87 | b.1.18.21 (A:77-163) 5'-AMP-activated protein kina | 6e-16 | |
| d2qlvb1 | 87 | b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisi | 2e-13 | |
| d1m3ga_ | 145 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 9e-13 | |
| d1mkpa_ | 144 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 3e-12 | |
| d1fpza_ | 176 | c.45.1.1 (A:) Kinase associated phosphatase (kap) | 2e-10 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 6e-09 | |
| d1ohea2 | 182 | c.45.1.1 (A:199-380) Proline directed phosphatase | 1e-08 | |
| d1i9sa_ | 194 | c.45.1.1 (A:) mRNA capping enzyme, triphosphatase | 2e-08 | |
| d1xria_ | 151 | c.45.1.1 (A:) Putative phosphatase At1g05000 {Thal | 4e-05 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 1e-04 |
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: VH1-related dual-specificity phosphatase, VHR species: Human (Homo sapiens) [TaxId: 9606]
Score = 80.2 bits (197), Expect = 4e-19
Identities = 24/136 (17%), Positives = 54/136 (39%), Gaps = 6/136 (4%)
Query: 6 IRPDLIVGSCLQTPEDVDKLRQIGVKTIFCLQQDPDLEYFGVDIIAIQEYAKTYDDIQHI 65
+ P + VG+ +D+ KL+++G+ + + + + ++ I ++
Sbjct: 26 VTPRIYVGNA-SVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKD-----SGITYL 79
Query: 66 RAEIRDFDAFDLRMRLPAVISKLYKAINRNGGVTYVHCTAGLGRAPAVALAYMFWVLGYK 125
+ D F+L + +A+ + G VHC G R+P + +AY+
Sbjct: 80 GIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMD 139
Query: 126 LNEAHQLLLSKRPCFP 141
+ A ++ R P
Sbjct: 140 VKSALSIVRQNREIGP 155
|
| >d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Rattus norvegicus [TaxId: 10116]} Length = 87 | Back information, alignment and structure |
|---|
| >d2qlvb1 b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} Length = 87 | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 151 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 283 | |||
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 99.98 | |
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 99.98 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 99.97 | |
| d2qlvb1 | 87 | SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} | 99.93 | |
| d1z0na1 | 87 | 5'-AMP-activated protein kinase subunit beta-1 {Ra | 99.93 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 99.91 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.9 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 99.84 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.84 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.79 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 99.78 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 98.99 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 98.97 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 98.61 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 98.53 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 98.46 | |
| d2bhua1 | 97 | Glycosyltrehalose trehalohydrolase, N-terminal dom | 98.45 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 98.41 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 98.4 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 98.38 | |
| d1m7xa1 | 110 | 1,4-alpha-glucan branching enzyme, N-terminal doma | 98.38 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 98.37 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 98.31 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 98.3 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 98.29 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 98.23 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 98.22 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 98.13 | |
| d1eh9a1 | 90 | Glycosyltrehalose trehalohydrolase, N-terminal dom | 97.46 | |
| d3bmva2 | 105 | Cyclodextrin glycosyltransferase, C-terminal domai | 97.18 | |
| d1kula_ | 108 | Glucoamylase, granular starch-binding domain {Aspe | 97.11 | |
| d1ohea1 | 157 | Proline directed phosphatase CDC14b2 {Human (Homo | 96.89 | |
| d1cyga2 | 106 | Cyclodextrin glycosyltransferase, C-terminal domai | 96.85 | |
| d1qhoa2 | 110 | Cyclodextrin glycosyltransferase, C-terminal domai | 96.8 | |
| d1vema1 | 99 | beta-amylase {Bacillus cereus [TaxId: 1396]} | 96.67 | |
| d2fhfa1 | 115 | Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 | 96.1 | |
| d3c8da1 | 145 | Enterochelin esterase {Shigella flexneri 2a str. 2 | 94.4 | |
| d1bf2a1 | 162 | Isoamylase, N-terminal domain N {Pseudomonas amylo | 93.14 | |
| d1zsqa2 | 387 | Myotubularin-related protein 2, C-terminal domain | 89.51 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 84.18 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 84.11 |
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: VH1-related dual-specificity phosphatase, VHR species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.98 E-value=6.5e-33 Score=226.88 Aligned_cols=141 Identities=18% Similarity=0.332 Sum_probs=124.2
Q ss_pred ccccccCCeEEcCCCCCcccHHHHHhcCCcEEEEcCcCCCCCccCCChHHHHHHhhhCCCeEEEEEeccCCCchhHhhhH
Q 040474 2 TYNFIRPDLIVGSCLQTPEDVDKLRQIGVKTIFCLQQDPDLEYFGVDIIAIQEYAKTYDDIQHIRAEIRDFDAFDLRMRL 81 (283)
Q Consensus 2 ~~~~I~~~l~lG~~p~~~~~~~~L~~~gI~~Vv~l~~~~e~~~~~~~~~~~~~~~~~~~~i~~~~ipi~D~~~~~~~~~~ 81 (283)
.+++|+|+||+|+.+ ++.+.+.|+++||++||||+.+.+...+...... + ...++.|+++|+.|.+..++..+|
T Consensus 22 p~~~I~~~LylG~~~-~a~d~~~L~~~gI~~Iin~~~~~~~~~~~~~~~~----~-~~~~i~y~~ipi~D~~~~~i~~~~ 95 (178)
T d1vhra_ 22 PCNEVTPRIYVGNAS-VAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANF----Y-KDSGITYLGIKANDTQEFNLSAYF 95 (178)
T ss_dssp SEEEEETTEEEECHH-HHTCHHHHHHHTCCEEEETTBSSSTTSBCCCHHH----H-TTTTCEEEECCCCCSTTCCGGGGH
T ss_pred CcCEeeCCEEECChh-HhcCHHHHHHcCCEEEEEcCcccccccccccccc----c-ccCCcEEEEEecCCCcchhHHHHH
Confidence 368999999999996 8999999999999999999987765444433221 1 235899999999999988999999
Q ss_pred HHHHHHHHHHHHcCCCEEEEEcCCCCChhHHHHHHHHHHHhCCCHHHHHHHHHhhCCCCCChhHHHH
Q 040474 82 PAVISKLYKAINRNGGVTYVHCTAGLGRAPAVALAYMFWVLGYKLNEAHQLLLSKRPCFPKLDAIKS 148 (283)
Q Consensus 82 ~~~~~~i~~~l~~~~~~VlVHC~~G~~RS~~v~~ayLm~~~~~~~~~A~~~v~~~r~~~pn~~~~~~ 148 (283)
..+++||++++.+++++|||||.+|+|||+++++||||++.||++++|+++|+++||..||.+|+.|
T Consensus 96 ~~~~~fi~~~~~~~~~~VLVHC~~G~sRS~~vv~aYLm~~~~~s~~~A~~~vr~~R~i~pn~~f~~q 162 (178)
T d1vhra_ 96 ERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQ 162 (178)
T ss_dssp HHHHHHHHHHHTSTTCCEEEECSSSSSHHHHHHHHHHHHHSCCCHHHHHHHHHHHSCCCCCHHHHHH
T ss_pred HHHHHHhhhhhhcCCceEEEEcCCCCccHHHHHHHHHHHhcCCCHHHHHHHHHhCCCCCCCHHHHHH
Confidence 9999999998866777999999999999999999999999999999999999999997799999987
|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qlvb1 b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bhua1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7xa1 b.1.18.2 (A:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1eh9a1 b.1.18.2 (A:1-90) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d3bmva2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d1kula_ b.3.1.1 (A:) Glucoamylase, granular starch-binding domain {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cyga2 b.3.1.1 (A:575-680) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qhoa2 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vema1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2fhfa1 b.1.18.2 (A:288-402) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d3c8da1 b.1.18.20 (A:6-150) Enterochelin esterase {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d1bf2a1 b.1.18.2 (A:1-162) Isoamylase, N-terminal domain N {Pseudomonas amyloderamosa [TaxId: 32043]} | Back information, alignment and structure |
|---|
| >d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|