Citrus Sinensis ID: 040531

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----

MNLNTEKKAYKTLEGKIAIVTGGARGIGEATVRLFVKHGAKVVIADIDDAAGIALADSLLSSSPLVTYLHCDVSLEQDIQNLINVTISKHGRLDILFNNAGVLGNQSKHKSITDFDANEFDNIIRINVRGAALGMKYAAKVMVPRRSGCIISTASVASLMGGLGPHAYTVSKHAIVGLTKNTACELGKYGIRVNCISPFGVATSMLVNAWKSCEDCMDSGKPCEEEEEKMEELVRGLANLKGVTLKARDIAEAALYLASDESKYISGHNLVVDGGFTTSKNCVGL

ccccccccccccccccEEEEcccccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccEEccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccEEEEccccccccccccc

**********KTLEGKIAIVTGGARGIGEATVRLFVKHGAKVVIADIDDAAGIALADSLLSSSPLVTYLHCDVSLEQDIQNLINVTISKHGRLDILFNNAGVLGNQSKHKSITDFDANEFDNIIRINVRGAALGMKYAAKVMVPRRSGCIISTASVASLMGGLGPHAYTVSKHAIVGLTKNTACELGKYGIRVNCISPFGVATSMLVNAWKSCEDCM************MEELVRGLANLKGVTLKARDIAEAALYLASDESKYISGHNLVVDGGFTTSKNCVGL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MNLNTEKKAYKTLEGKIAIVTGGARGIGEATVRLFVKHGAKVVIADIDDAAGIALADSLLSSSPLVTYLHCDVSLEQDIQNLINVTISKHGRLDILFNNAGVLGNQSKHKSITDFDANEFDNIIRINVRGAALGMKYAAKVMVPRRSGCIISTASVASLMGGLGPHAYTVSKHAIVGLTKNTACELGKYGIRVNCISPFGVATSMLVNAWKSCEDCMDSGKPxxxxxxxxxxxxxxxxxxxxxTLKARDIAEAALYLASDESKYISGHNLVVDGGFTTSKNCVGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Short-chain dehydrogenase reductase 2a		probable	Q9SCU0
3-hydroxybutyrate dehydrogenase type 2	Dehydrogenase that mediates the formation of 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin and associates with LCN2, thereby playing a key role in iron homeostasis and transport. Also acts as a 3-hydroxybutyrate dehydrogenase.	probable	Q3T046
Sex determination protein tasselseed-2	Required for stage-specific floral organ abortion.	probable	P50160

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BGK, chain A
Confidence level:very confident
Coverage over the Query: 10-212,226-280
View the alignment between query and template
View the model in PyMOL