Citrus Sinensis ID: 040548


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-
MSSSCPAGKGSWPELVGMNGEAAAHIIMAENPKVGATTVDENAIVTADFRCDRVRVFVNDHGIVTRVPRIG
cccccccccccccccccccHHHHHHHHHHHccccEEEEEcccccccccccccEEEEEEcccccEECccccc
***********WPELVGMNGEAAAHIIMAENPKVGATTVDENAIVTADFRCDRVRVFVNDHGIVTRVPRIG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSCPAGKGSWPELVGMNGEAAAHIIMAENPKVGATTVDENAIVTADFRCDRVRVFVNDHGIVTRVPRIG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Trypsin/subtilisin inhibitor Inhibitor of trypsin, chymotrypsin, subtilisin, etc.probableP80211
Protease inhibitor HPI Inhibitor of serine proteases, strongly inhibits subtilisin A and weakly inhibits trypsin. Does not inhibit chymotrypsin, papain, pepsin, pronase E, protease type XIII and thermolysin. HPI-1 inhibits subtilisin A with an Ki of 0.21 nM. HPI-2a inhibits subtilisin A with an Ki of 0.08 nM. HPI-2b inhibits subtilisin A with an Ki of 0.1 nM.probableQ6XNP7
Proteinase inhibitor In vitro, strong inhibitor of bovine beta-trypsin, weak inhibitor of alpha-chymotrypsin, subtilisin BPN', subtilisin Carlsberg and cathepsin G.probableP82381

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DWM, chain A
Confidence level:very confident
Coverage over the Query: 2-71
View the alignment between query and template
View the model in PyMOL