Citrus Sinensis ID: 040625

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-----

CGAMTHNAKSCMERPRKIGAKWTNMHIAPDEKIESFELDYDGKRDRWNGFDPATYALVIERYEARDEARRKYLKEQQLKKLEEKNSKQNGEGGVSEEDDDEDALKVDEAKVDESKQMDFAKVEKRVRTTGGGSTGTVRNLRIREDTAKYLLNLDVNSAYYDPKTRSMREDPLPDADPNEKFYGGDNQNRLSGQALEFKQLNNYNVIKEKLKSRLKDIIAEKYGNAASEEEIPRELLLGQSERQVEYDRAGRIIQGVESFLPRSKYEEDVYINNHTSVWGSWWKDHQWGYKCCKQTIKNNLMKANVARKAASEDMRAPAEEKNLATWGTDVPDNLNLDQKQLAEALRKEDERKKEEKDERKRKYNVRWNDEVTAEEMEAYRMKKIHHDDPMKDFLY

cccccccccccccccccccccccccccccccEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHccccHHHccccccccccccccccccccHHHHHcccccEEEEcccccccccccccccccccccccccHHHHHHHHcccccHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccHHHccc

**********CMERPRKIGAKWTNMHIAPDEKIESFELDYDGKRDRWNGFDPATYALVIERYEA************************************************************************VRNLRIREDTAKYLLNLDVNSAYYDP*******************YGGDN********LEFKQLNNYNVIKEKLKSRLKDIIAEKYG************LL*****QVEYDRAGRIIQGVESFLPRSKYEEDVYINNHTSVWGSWWKDHQWGYKCCKQTIKNNLMKA****************************************************************************RMK**HHDDPMKDFL*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

CGAMTHNAKSCMERPRKIGAKWTNMHIAPDEKIESFELDYDGKRDRWNGFDPATYALVIERYEARDEARRKYLKEQQLKKLEEKNSKQNGEGGVSEEDDDEDALKVDEAKVDESKQMDFAKVEKRVRTTGGGSTGTVRNLRIREDTAKYLLNLDVNSAYYDPKTRSMREDPLPDADPNEKFYGGDNQNRLSGQALEFKQxxxxxxxxxxxxxxxxxxxxxKYGNAASEEEIPRELLLGQSERQVEYDRAGRIIQGVESFLPRSKYEEDVYINNHTSVWGSWWKDHQWGYKCCKQTIKNNLMKANVARKAASEDMRAPAEEKNLATWGTDVPDNLNLDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWNDEVTAEEMEAYRMKKIHHDDPMKDFLY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Pre-mRNA-splicing factor SLU7	Participates in the second catalytic step of pre-mRNA splicing, when the free hydroxyl group of exon I attacks the 3'-splice site to generate spliced mRNA and the excised lariat intron.	probable	Q6ZK48
Pre-mRNA-splicing factor SLU7-A	Participates in the second catalytic step of pre-mRNA splicing, when the free hydroxyl group of exon I attacks the 3'-splice site to generate spliced mRNA and the excised lariat intron.	probable	Q9SHY8
Pre-mRNA-splicing factor SLU7	Participates in the second catalytic step of pre-mRNA splicing, when the free hydroxyl group of exon I attacks the 3'-splice site to generate spliced mRNA and the excised lariat intron.	probable	A2YQU8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
1nc8, chain A		probable	Alignment \| Template Structure