Citrus Sinensis ID: 040647


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
RPENNPLDLNNLPEDYSKQVLDESSSTGAGAGHRKKKSGAKDGKDDECGKVYECRFCSLKFCKSQALGGHMNRHRQERETETLNKARQLVFQHNDNLAVQGPPPHLGCHPMTPGSYHPAGHIGDPFRSIYPPRLYSTGSSSTLISPPPPPPQPPQYPYPSSTSLASCPSHQYPPHQPMNELYVGHVLSSSPHSQYPHNQSNLNNFMDSSYTCIGAPVGHGFVAGSSRGSDMAGSSSGGRDGSLSNQDQDGDCCSFIFELMYTLSYFGFKPFGIDDYSIGATYYNQL
ccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccEEcccc
ccccccccccccccccccEEEcccccccccccccccccccccccccccccEEEEEEccHHHHHcHHccccHcHHHHHHHHHHHHHHHHHHccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccEcHEEEccc
rpennpldlnnlpedyskqvldessstgagaghrkkksgakdgkddecgkvyecrfcslkfcksqalgghmnrhrqERETETLNKARQLVFQHndnlavqgppphlgchpmtpgsyhpaghigdpfrsiypprlystgssstlisppppppqppqypypsstslascpshqypphqpmnelyvghvlsssphsqyphnqsnlnnfmdssytcigapvghgfvagssrgsdmagsssggrdgslsnqdqdgdcCSFIFELMYTlsyfgfkpfgiddysigatyynql
rpennpldlnnlpedySKQVLDessstgagaghrkkksgakdgkddecGKVYECRFCSLKFCKSQALGGHMNRHRQERETETLNKARQLVFQHNDNLAVQGPPPHLGCHPMTPGSYHPAGHIGDPFRSIYPPRLYSTGSSSTLISPPPPPPQPPQYPYPSSTSLASCPSHQYPPHQPMNELYVGHVLSSSPHSQYPHNQSNLNNFMDSSYTCIGAPVGHGFVAGSSRGSDMAGSSSGGRDGSLSNQDQDGDCCSFIFELMYTLSYFGFKPFGIDDYSIGATYYNQL
RpennpldlnnlpedYSKQVLDESSSTGAGAGHRkkksgakdgkddECGKVYECRFCSLKFCKSQALGGHMNRHRQERETETLNKARQLVFQHNDNLAVQGPPPHLGCHPMTPGSYHPAGHIGDPFRSIYPPRlystgssstlisppppppqppqypypsstslASCPSHQYPPHQPMNELYVGHVLSSSPHSQYPHNQSNLNNFMDSSYTCIGAPVGHGFVagssrgsdmagsssggrdgsLSNQDQDGDCCSFIFELMYTLSYFGFKPFGIDDYSIGATYYNQL
***********************************************CGKVYECRFCSLKFCKSQAL**********************VF******************************I***FR*IY**************************************************************************FMDSSYTCIGAPVGHGFV****************************DCCSFIFELMYTLSYFGFKPFGIDDYSIGATYY***
****NPL*********************************************ECRFCSLKFCKSQALGGHM*R**************************QGPPPHLGCHPMTPGSY***********************************************************************************************CIGA***********************************DCCSFIFELMYTLSYFGFKPFGIDDYSIGATYYNQ*
RPENNPLDLNNLPEDYSKQV*************************DECGKVYECRFCSLKFCKSQAL*************ETLNKARQLVFQHNDNLAVQGPPPHLGCHPMTPGSYHPAGHIGDPFRSIYPPRLYST*******************************SHQYPPHQPMNELYVGHVLSSSPHSQYPHNQSNLNNFMDSSYTCIGAPVGHGFVAGS*********************DQDGDCCSFIFELMYTLSYFGFKPFGIDDYSIGATYYNQL
*****PLDLNNLPEDYSKQVLD**************************GKVYECRFCSLKFCKSQALGGHMNRHRQERETETLNKARQLVFQHNDNLAVQGPPPHLGCHPMTPGSYHPAGHIGDPFRSIYPPRLYSTGSSSTLISPPPPPPQPPQYPYPSSTSLASCPSHQYPPHQPMNELYVGHVLSSSPHSQYPHNQSNLNNFMDSSYTCIGAPVGHGFVA**************************GDCCSFIFELMYTLSYFGFKPFGIDDYSIGATYYNQL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RPENNPLDLNNLPEDYSKQVLDESSSTGAGAGHRKKKSGAKDGKDDECGKVYECRFCSLKFCKSQALGGHMNRHRQERETETLNKARQLVFQHNDNLAVQGPPPHLGCHPMTPGSYHPAGHIGDPFRSIYPPRLYSTGSSSTLISPPPPPPQPPQYPYPSSTSLASCPSHQYPPHQPMNELYVGHVLSSSPHSQYPHNQSNLNNFMDSSYTCIGAPVGHGFVAGSSRGSDMAGSSSGGRDGSLSNQDQDGDCCSFIFELMYTLSYFGFKPFGIDDYSIGATYYNQL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query286 2.2.26 [Sep-21-2011]
Q6S591253 Zinc finger protein JAGGE yes no 0.783 0.885 0.463 1e-36
Q9LG97263 Zinc finger protein STAME yes no 0.349 0.380 0.647 5e-28
Q6S592207 Zinc finger protein JAGGE no no 0.643 0.888 0.406 2e-26
Q39265197 Zinc finger protein 6 OS= no no 0.346 0.502 0.297 1e-05
>sp|Q6S591|JAG_ARATH Zinc finger protein JAGGED OS=Arabidopsis thaliana GN=JAG PE=2 SV=1 Back     alignment and function desciption
 Score =  153 bits (387), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 148/261 (56%), Gaps = 37/261 (14%)

Query: 1   RPENNPLDLNNLPEDYSKQVLDESSSTGAGAGHRKKKSGAKDGKDDECGKVYECRFCSLK 60
           R E N LDLNNLP+D+SK    ++   G+ +G RKKK G+K+GKD E GKVYECRFCSLK
Sbjct: 2   RHEENYLDLNNLPDDFSKDGNKQALEEGSSSGQRKKK-GSKEGKD-ESGKVYECRFCSLK 59

Query: 61  FCKSQALGGHMNRHRQERETETLNKARQLVFQHNDNLAVQGPPPHLGCHPMTPGSYHPAG 120
           FCKSQALGGHMNRHRQERETETLN+ARQLV++ ND +   G         ++P  YH   
Sbjct: 60  FCKSQALGGHMNRHRQERETETLNQARQLVYR-NDTITPPG---------ISPFGYH--- 106

Query: 121 HIGDP--FRSIY-PPRLYSTGSSSTLISPPPPPPQPPQYPYPSSTSLASCPSHQYPPHQP 177
           H  DP  +RS+Y  P +Y   SS+ L+  PP PP PP YPY S+         QY PH  
Sbjct: 107 HTTDPTIYRSVYSSPMIYPGSSSTNLVPQPPMPPPPPPYPYSSN---------QYSPHNH 157

Query: 178 MNELYVGHVL----SSSPHSQYPHNQSNLNNFMDS----SYTCIGAPVG-HGFVAGSSRG 228
            N+ Y+        S SP    P   + ++   DS     YTC+GAP+G  GF       
Sbjct: 158 FNDYYLNPSFRGSRSISPSPNLP-TTTTVDYMADSPVEPGYTCVGAPIGPTGFPIRGPSI 216

Query: 229 SDMAGSSSGGRDGSLSNQDQD 249
                    GRDG  S Q  D
Sbjct: 217 VRAPLEPPQGRDGDASRQRLD 237




Controls the morphogenesis of lateral organs. Functions in lateral organ shape and is sufficient to induce proliferation and growth of lateral organ tissue. Is necessary and sufficient for bract formation, but its expression is excluded from the cryptic bract, which could be a cause of bractless flowers in Arabidopsis. Participates with FIL and YAB3 in regulating valve margin development. Functions with JGL to define stamen and carpel shape. Functions with AS1 and AS2 in the sepal and petal primordia to repress boundary-specifying genes for normal development of the organs.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LG97|SL1_ORYSJ Zinc finger protein STAMENLESS 1 OS=Oryza sativa subsp. japonica GN=SL1 PE=2 SV=1 Back     alignment and function description
>sp|Q6S592|JGL_ARATH Zinc finger protein JAGGED-like OS=Arabidopsis thaliana GN=JGL PE=2 SV=1 Back     alignment and function description
>sp|Q39265|ZFP6_ARATH Zinc finger protein 6 OS=Arabidopsis thaliana GN=ZFP6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
224111680285 predicted protein [Populus trichocarpa] 0.800 0.803 0.630 2e-64
359472690283 PREDICTED: zinc finger protein JAGGED-li 0.709 0.717 0.634 9e-58
449445254 518 PREDICTED: uncharacterized protein LOC10 0.737 0.407 0.571 4e-53
297737812310 unnamed protein product [Vitis vinifera] 0.646 0.596 0.616 7e-52
449502480313 PREDICTED: zinc finger protein JAGGED-li 0.737 0.674 0.558 3e-44
186970563259 lyrate [Solanum lycopersicum] 0.681 0.752 0.501 9e-41
297841571253 hypothetical protein ARALYDRAFT_475967 [ 0.783 0.885 0.478 2e-36
79375919253 zinc finger-related protein [Arabidopsis 0.783 0.885 0.463 8e-35
75334976263 RecName: Full=Zinc finger protein STAMEN 0.349 0.380 0.647 3e-26
255581631185 nucleic acid binding protein, putative [ 0.458 0.708 0.531 1e-24
>gi|224111680|ref|XP_002315939.1| predicted protein [Populus trichocarpa] gi|222864979|gb|EEF02110.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  251 bits (642), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 162/257 (63%), Positives = 192/257 (74%), Gaps = 28/257 (10%)

Query: 1   RPENNPLDLNNLPEDYS---KQVLDESSSTGAGAGHRKKKSGAKDGKDDECGKVYECRFC 57
           R ENNPLDLNNLPEDYS   KQVLDE SS+G    +RKKKSGAK+GK+ E  KVYECRFC
Sbjct: 18  RHENNPLDLNNLPEDYSRDGKQVLDEGSSSG----YRKKKSGAKNGKE-EGDKVYECRFC 72

Query: 58  SLKFCKSQALGGHMNRHRQ-ERETETLNKARQLVFQHNDNLAVQGPPPHLGCHPMTPGSY 116
           SLKFCKSQALGGHMNRHRQ +RETETLN+ARQLVF ++D LA   P  H GCHPM  GSY
Sbjct: 73  SLKFCKSQALGGHMNRHRQGKRETETLNRARQLVF-NSDTLAA--PGGHPGCHPMGTGSY 129

Query: 117 HPAGHIGDPFRSIYPPRLYSTGSSSTLISPPPPPPQPPQ-YPYPSSTSLASCPSHQYPPH 175
            PAG+IGDPFRS+YPPRL+  GSSSTL+ P PP   P Q Y Y   + L +  S QY P 
Sbjct: 130 IPAGNIGDPFRSVYPPRLF-PGSSSTLL-PAPPNQHPHQSYLYTPPSRLPAYKS-QY-PQ 185

Query: 176 QPMNELYVGHVLSSSPHSQYPHNQSNLNNFM---DSSYTCIGAPVGH-GFVAGSSRGSDM 231
           QP+N+ Y+GHVL+++  + YP +Q N+N  M   +S+YTCIGAPVGH GF  GSSR ++ 
Sbjct: 186 QPINDYYIGHVLNNTSQT-YPSHQ-NMNYNMGGSESNYTCIGAPVGHGGFGPGSSRSTEG 243

Query: 232 AGSSSGGRDGSLSNQDQ 248
           +     GRDGSLSNQ++
Sbjct: 244 S-----GRDGSLSNQEE 255




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359472690|ref|XP_003631186.1| PREDICTED: zinc finger protein JAGGED-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449445254|ref|XP_004140388.1| PREDICTED: uncharacterized protein LOC101215991 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297737812|emb|CBI27013.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449502480|ref|XP_004161652.1| PREDICTED: zinc finger protein JAGGED-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|186970563|gb|ACC99356.1| lyrate [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|297841571|ref|XP_002888667.1| hypothetical protein ARALYDRAFT_475967 [Arabidopsis lyrata subsp. lyrata] gi|297334508|gb|EFH64926.1| hypothetical protein ARALYDRAFT_475967 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|79375919|ref|NP_177015.3| zinc finger-related protein [Arabidopsis thaliana] gi|75324671|sp|Q6S591.1|JAG_ARATH RecName: Full=Zinc finger protein JAGGED gi|39726198|gb|AAR30036.1| JAGGED [Arabidopsis thaliana] gi|332196677|gb|AEE34798.1| zinc finger-related protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|75334976|sp|Q9LG97.1|SL1_ORYSJ RecName: Full=Zinc finger protein STAMENLESS 1; AltName: Full=OsJAG; AltName: Full=Zinc finger protein OPEN BEAK gi|9558464|dbj|BAB03385.1| C2H2 zinc-finger transcription factor -like [Oryza sativa Japonica Group] gi|169135755|gb|ACA48519.1| stamenless 1 [Oryza sativa Japonica Group] gi|219687079|dbj|BAH09094.1| OPEN BEAK [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|255581631|ref|XP_002531619.1| nucleic acid binding protein, putative [Ricinus communis] gi|223528737|gb|EEF30747.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
TAIR|locus:2201302253 JAG "AT1G68480" [Arabidopsis t 0.332 0.375 0.534 3.7e-29
TAIR|locus:2009952207 NUB "AT1G13400" [Arabidopsis t 0.265 0.367 0.640 2.5e-26
UNIPROTKB|Q9LG97263 SL1 "Zinc finger protein STAME 0.297 0.323 0.609 6.4e-26
TAIR|locus:2143300278 AT5G27880 "AT5G27880" [Arabido 0.374 0.384 0.336 3.6e-07
TAIR|locus:2175309201 AT5G05120 "AT5G05120" [Arabido 0.125 0.179 0.583 3.9e-07
TAIR|locus:2158367137 AT5G43540 "AT5G43540" [Arabido 0.195 0.408 0.437 5.8e-07
TAIR|locus:2174547150 ZFP2 "AT5G57520" [Arabidopsis 0.192 0.366 0.396 2.9e-06
TAIR|locus:2019723197 ZFP6 "AT1G67030" [Arabidopsis 0.213 0.309 0.405 4.7e-06
TAIR|locus:2156529173 LATE "LATE FLOWERING" [Arabido 0.276 0.456 0.352 0.00017
TAIR|locus:2181007215 AT5G01860 "AT5G01860" [Arabido 0.188 0.251 0.423 0.00044
TAIR|locus:2201302 JAG "AT1G68480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 261 (96.9 bits), Expect = 3.7e-29, Sum P(2) = 3.7e-29
 Identities = 62/116 (53%), Positives = 73/116 (62%)

Query:    17 SKQVLDESSSTGAGAGHRXXXXXXXXXXXXECGKVYECRFCSLKFCKSQALGGHMNRHRQ 76
             +KQ L+E SS+G                  E GKVYECRFCSLKFCKSQALGGHMNRHRQ
Sbjct:    22 NKQALEEGSSSGQ------RKKKGSKEGKDESGKVYECRFCSLKFCKSQALGGHMNRHRQ 75

Query:    77 ERETETLNKARQLVFQHNDNLAVQGPPPHLGCHPMTPGSYHPAGHIGDP--FRSIY 130
             ERETETLN+ARQLV++ ND +     PP +     +P  YH   H  DP  +RS+Y
Sbjct:    76 ERETETLNQARQLVYR-NDTIT----PPGI-----SPFGYH---HTTDPTIYRSVY 118


GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009908 "flower development" evidence=IMP
GO:0010093 "specification of floral organ identity" evidence=RCA;IMP
GO:0009965 "leaf morphogenesis" evidence=IMP
GO:0010158 "abaxial cell fate specification" evidence=IMP
GO:0048440 "carpel development" evidence=IGI;RCA
GO:0048443 "stamen development" evidence=IGI
GO:0048653 "anther development" evidence=IGI
GO:0048451 "petal formation" evidence=RCA
GO:0048453 "sepal formation" evidence=RCA
GO:0048507 "meristem development" evidence=RCA
TAIR|locus:2009952 NUB "AT1G13400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9LG97 SL1 "Zinc finger protein STAMENLESS 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2143300 AT5G27880 "AT5G27880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175309 AT5G05120 "AT5G05120" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158367 AT5G43540 "AT5G43540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174547 ZFP2 "AT5G57520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019723 ZFP6 "AT1G67030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156529 LATE "LATE FLOWERING" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181007 AT5G01860 "AT5G01860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 286
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.74
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.59
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.35
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.35
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.27
KOG1074958 consensus Transcriptional repressor SALM [Transcri 99.19
KOG3576267 consensus Ovo and related transcription factors [T 99.18
PHA0276855 hypothetical protein; Provisional 98.81
KOG3608467 consensus Zn finger proteins [General function pre 98.76
KOG3608467 consensus Zn finger proteins [General function pre 98.48
KOG3576267 consensus Ovo and related transcription factors [T 98.46
PHA00733128 hypothetical protein 98.43
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.32
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.11
PLN03086567 PRLI-interacting factor K; Provisional 98.05
PHA0061644 hypothetical protein 98.03
PHA0276855 hypothetical protein; Provisional 97.99
PHA0073279 hypothetical protein 97.72
PLN03086567 PRLI-interacting factor K; Provisional 97.46
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.38
PHA00733128 hypothetical protein 97.01
KOG3993500 consensus Transcription factor (contains Zn finger 96.96
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.86
PHA0073279 hypothetical protein 96.73
COG5189423 SFP1 Putative transcriptional repressor regulating 96.59
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.57
PHA0061644 hypothetical protein 96.39
smart0035526 ZnF_C2H2 zinc finger. 96.31
PRK04860160 hypothetical protein; Provisional 96.29
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.0
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.28
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 94.81
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 94.67
COG5048467 FOG: Zn-finger [General function prediction only] 94.44
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 94.29
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.73
COG5189423 SFP1 Putative transcriptional repressor regulating 93.71
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 93.62
COG5048467 FOG: Zn-finger [General function prediction only] 93.43
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 93.34
KOG3993500 consensus Transcription factor (contains Zn finger 92.6
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 91.79
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 91.56
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 90.35
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 90.33
KOG2893341 consensus Zn finger protein [General function pred 89.29
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 89.26
smart0035526 ZnF_C2H2 zinc finger. 88.35
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 87.07
PRK04860160 hypothetical protein; Provisional 85.62
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 80.32
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.74  E-value=9.7e-19  Score=159.79  Aligned_cols=94  Identities=20%  Similarity=0.306  Sum_probs=87.7

Q ss_pred             hhcccccCCCchhhhhhhccC---CCCccCCCCCCc-----------------ccccCcCCcccCCchhhhhhhhhcCCC
Q 040647           18 KQVLDESSSTGAGAGHRKKKS---GAKDGKDDECGK-----------------VYECRFCSLKFCKSQALGGHMNRHRQE   77 (286)
Q Consensus        18 ~~C~k~F~~~s~L~~H~r~Ht---GeKpf~C~~~eK-----------------Py~C~~Cgk~F~~ss~L~~H~r~Htge   77 (286)
                      ..|+|.+.+.++|.+|+.+|.   ..|.+.|+.|+|                 +++|.+|||.|.+.--|+.|+|+||||
T Consensus       134 ~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGHiRTHTGE  213 (279)
T KOG2462|consen  134 PECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGHIRTHTGE  213 (279)
T ss_pred             cccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhcccccccCC
Confidence            789999999999999999884   467899999986                 899999999999999999999999999


Q ss_pred             cccccCCCCcccccCCchhhhhcCCCCCCCCCCCCCC
Q 040647           78 RETETLNKARQLVFQHNDNLAVQGPPPHLGCHPMTPG  114 (286)
Q Consensus        78 KPy~C~~Cgr~~sFs~~s~L~~H~r~~H~g~kP~~~~  114 (286)
                      |||.|..|+|  +|..+++|+.|++ +|.+.|.|.|.
T Consensus       214 KPF~C~hC~k--AFADRSNLRAHmQ-THS~~K~~qC~  247 (279)
T KOG2462|consen  214 KPFSCPHCGK--AFADRSNLRAHMQ-THSDVKKHQCP  247 (279)
T ss_pred             CCccCCcccc--hhcchHHHHHHHH-hhcCCccccCc
Confidence            9999999999  9999999999999 99999999863



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 3e-12
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 8e-04
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 Back     alignment and structure
 Score = 59.0 bits (143), Expect = 3e-12
 Identities = 17/34 (50%), Positives = 22/34 (64%)

Query: 50 KVYECRFCSLKFCKSQALGGHMNRHRQERETETL 83
          + Y C FC  +F  +QALGGHMN HR++R    L
Sbjct: 5  RSYTCSFCKREFRSAQALGGHMNVHRRDRARLRL 38


>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.69
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.67
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.67
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.67
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.65
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.64
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.63
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.62
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.61
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.6
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.59
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.56
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.55
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.55
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.54
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.54
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.52
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.52
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.52
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.52
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.51
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.51
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.49
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.48
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.47
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.47
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.46
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.44
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.43
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.42
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.41
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.41
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.4
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.4
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.36
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.35
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.35
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.33
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.33
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.32
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.3
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.28
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.27
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.26
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.25
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.24
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.23
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.23
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.22
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.22
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.22
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.22
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.21
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.21
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.21
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.21
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.21
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.2
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.2
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.2
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.2
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.19
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.19
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.18
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.17
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.17
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.17
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.16
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.15
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.15
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.15
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.13
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.12
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.11
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.1
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.05
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.03
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.03
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.03
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.02
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.01
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.0
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.99
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.98
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.97
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.96
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.95
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 98.94
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.93
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.9
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.9
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 98.9
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.89
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.87
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.85
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.83
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.83
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.82
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.81
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.81
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.8
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.8
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.79
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.78
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.78
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.78
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.78
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.78
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.78
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.77
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.77
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.77
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.76
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.76
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.75
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.75
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.75
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.74
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.74
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.74
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.74
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.74
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.73
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.73
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.73
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.73
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.73
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.73
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.72
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.72
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.72
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.72
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.72
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.72
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.72
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.72
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.72
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.72
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.71
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.71
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.71
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.71
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.7
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.7
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.7
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.7
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.7
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.7
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.7
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.7
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.69
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.69
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.69
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.68
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.68
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.68
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.68
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.68
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.68
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.68
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.68
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.67
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.67
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.67
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.67
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.66
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.66
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.66
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.66
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.65
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.65
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.65
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.64
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.64
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.64
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.63
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.63
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.63
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.63
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.63
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.63
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.62
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.62
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.61
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.61
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.61
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.59
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.59
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.59
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.58
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.56
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.56
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.54
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.53
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.53
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.52
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.52
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.49
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.46
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.4
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.39
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.39
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.38
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.37
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.37
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.35
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.35
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.35
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.35
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.33
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.31
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.64
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.3
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.3
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.63
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.29
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.28
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.27
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.25
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.25
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.24
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.24
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.21
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.19
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.19
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.17
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.17
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.16
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.12
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.11
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.07
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.05
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.31
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.04
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.04
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.0
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.99
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.97
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.97
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.97
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.94
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.89
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.86
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 97.84
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.83
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 97.83
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.67
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.65
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.58
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.52
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.64
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.49
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.47
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.47
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.46
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.56
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.42
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.4
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.34
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.25
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.25
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.24
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.21
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.13
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.21
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.13
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.48
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.46
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.21
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.44
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.43
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 92.51
2e72_A49 POGO transposable element with ZNF domain; zinc fi 89.84
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 84.33
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 84.32
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
Probab=99.69  E-value=6.5e-18  Score=133.08  Aligned_cols=90  Identities=22%  Similarity=0.280  Sum_probs=84.0

Q ss_pred             hhcccccCCCchhhhhhhccCCCCccCCCCCC----------------------cccccCcCCcccCCchhhhhhhhhcC
Q 040647           18 KQVLDESSSTGAGAGHRKKKSGAKDGKDDECG----------------------KVYECRFCSLKFCKSQALGGHMNRHR   75 (286)
Q Consensus        18 ~~C~k~F~~~s~L~~H~r~HtGeKpf~C~~~e----------------------KPy~C~~Cgk~F~~ss~L~~H~r~Ht   75 (286)
                      ..|++.|.....|..|+++|+++++|.|.+|+                      ++|.|.+|++.|.....|.+|+++|+
T Consensus        11 ~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~   90 (124)
T 2dlq_A           11 PTCHKKFLSKYYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFRRRMELRLHMVSHT   90 (124)
T ss_dssp             TTTCCCCSSHHHHHHHHHHHSSCCSCBCTTTCCBCSSHHHHHHHHHHCCCCSCCCCEECSSSCCEESSHHHHHHHHHHHS
T ss_pred             CCCCCcCCCHHHHHHHHHhCCCCCCeECCCCCchhcCHHHHHHHHhhhhcCCCCCCeECCCCCCccCCHHHHHHHHHHcC
Confidence            88999999999999999999999999999865                      47999999999999999999999999


Q ss_pred             CCcccccCCCCcccccCCchhhhhcCCCCCCCCC
Q 040647           76 QERETETLNKARQLVFQHNDNLAVQGPPPHLGCH  109 (286)
Q Consensus        76 geKPy~C~~Cgr~~sFs~~s~L~~H~r~~H~g~k  109 (286)
                      ++++|+|..|++  .|.....|++|++..|.++.
T Consensus        91 ~~~~~~C~~C~~--~f~~~~~l~~H~~~~H~~~~  122 (124)
T 2dlq_A           91 GEMPYKCSSCSQ--QFMQKKDLQSHMIKLHSGPS  122 (124)
T ss_dssp             SSCSEECSSSCC--EESSHHHHHHHHHHTSSCSS
T ss_pred             CCCCccCCCccc--hhCCHHHHHHHHHHHCCCCC
Confidence            999999999999  99999999999875787653



>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 286
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 2e-10
d1x6fa175 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 0.004
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Plant C2H2 finger (QALGGH zinc finger)
domain: SUPERMAN zinc finger domain
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 52.8 bits (127), Expect = 2e-10
 Identities = 17/34 (50%), Positives = 22/34 (64%)

Query: 50 KVYECRFCSLKFCKSQALGGHMNRHRQERETETL 83
          + Y C FC  +F  +QALGGHMN HR++R    L
Sbjct: 4  RSYTCSFCKREFRSAQALGGHMNVHRRDRARLRL 37


>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.55
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.24
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.17
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.15
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.06
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.05
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.01
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.01
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.93
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.92
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.92
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.9
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.88
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.85
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.84
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.81
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.76
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.76
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.76
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.74
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.7
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.68
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.66
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.65
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.59
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.5
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.49
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.46
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.42
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.4
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.34
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.34
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.31
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.2
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.05
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.98
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.93
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.92
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.91
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.79
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.79
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.75
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.64
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.61
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.58
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.52
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.46
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.36
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.27
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.23
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.06
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.0
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.91
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.86
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.67
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.54
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.53
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.51
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.46
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.36
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.31
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.25
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.2
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.18
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.15
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.14
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.9
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.63
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.59
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.2
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 95.11
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 94.79
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 94.54
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 94.26
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.19
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.79
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.52
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.23
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.37
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 92.22
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 92.16
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 91.74
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.7
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 91.36
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.76
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.16
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 90.04
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 89.24
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 88.02
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 87.52
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 87.52
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 87.29
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 87.09
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.23
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 84.56
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 83.86
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 83.25
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 80.95
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.55  E-value=4.8e-16  Score=107.10  Aligned_cols=53  Identities=23%  Similarity=0.334  Sum_probs=50.8

Q ss_pred             CcccccCcCCcccCCchhhhhhhhhcCCCcccccCCCCcccccCCchhhhhcCCCCC
Q 040647           49 GKVYECRFCSLKFCKSQALGGHMNRHRQERETETLNKARQLVFQHNDNLAVQGPPPH  105 (286)
Q Consensus        49 eKPy~C~~Cgk~F~~ss~L~~H~r~HtgeKPy~C~~Cgr~~sFs~~s~L~~H~r~~H  105 (286)
                      ||||+|+ |+|.|....+|..|+++|+++|||+|.+|++  .|.+.+.|.+|++ +|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k--~F~~~~~L~~H~r-~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGK--KFKMKHHLVGHMK-IH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSC--EESSSHHHHHHHT-TT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCC--EecCHHHHHHHHh-cC
Confidence            6899995 9999999999999999999999999999999  9999999999998 66



>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure