Citrus Sinensis ID: 040653
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 228 | ||||||
| 387135362 | 316 | tannin-related R2R3 MYB transcription fa | 0.530 | 0.382 | 0.541 | 2e-27 | |
| 387135352 | 316 | tannin-related R2R3 MYB transcription fa | 0.530 | 0.382 | 0.541 | 2e-27 | |
| 387135346 | 316 | tannin-related R2R3 MYB transcription fa | 0.530 | 0.382 | 0.534 | 4e-27 | |
| 387135342 | 312 | tannin-related R2R3 MYB transcription fa | 0.824 | 0.602 | 0.393 | 2e-26 | |
| 387135334 | 311 | tannin-related R2R3 MYB transcription fa | 0.820 | 0.601 | 0.398 | 2e-26 | |
| 387135338 | 311 | tannin-related R2R3 MYB transcription fa | 0.820 | 0.601 | 0.398 | 2e-26 | |
| 387135336 | 311 | tannin-related R2R3 MYB transcription fa | 0.714 | 0.524 | 0.431 | 5e-26 | |
| 356545756 | 304 | PREDICTED: transcription factor MYB12-li | 0.706 | 0.529 | 0.447 | 6e-26 | |
| 359484279 | 301 | PREDICTED: transcription factor TT2-like | 0.631 | 0.478 | 0.435 | 6e-26 | |
| 387135332 | 310 | tannin-related R2R3 MYB transcription fa | 0.530 | 0.390 | 0.529 | 1e-25 |
| >gi|387135362|gb|AFJ53059.1| tannin-related R2R3 MYB transcription factor [Medicago sativa] | Back alignment and taxonomy information |
|---|
Score = 128 bits (322), Expect = 2e-27, Method: Compositional matrix adjust.
Identities = 71/131 (54%), Positives = 93/131 (70%), Gaps = 10/131 (7%)
Query: 1 CGKSCRLRWLNYLRPDIKRGNISHDEDELIIRLLNLLANRWSLIAGRLPGRTDNE--NMK 58
CGKSCRLRWLNYLRPDIKRGNIS DE+ELIIRL LL NRWSLIAGRLPGRTDNE N
Sbjct: 49 CGKSCRLRWLNYLRPDIKRGNISPDEEELIIRLHKLLGNRWSLIAGRLPGRTDNEIKNYW 108
Query: 59 SRIIGAPTLENKKLQDHHQSPSSSTACTRKTLNQCQEKPKLGSKKFIAKTDSYPIRTRAS 118
+ +G KK++D Q +++++ T+ L+ + K+ K+ K +SY +RT+A+
Sbjct: 109 NTNLG------KKVKDLDQQNTNNSSPTK--LSAQPKNAKIKQKQINPKPNSYVVRTKAT 160
Query: 119 KRTKALFFSTP 129
K +K LF ++P
Sbjct: 161 KCSKVLFINSP 171
|
Source: Medicago sativa Species: Medicago sativa Genus: Medicago Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|387135352|gb|AFJ53057.1| tannin-related R2R3 MYB transcription factor, partial [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|387135346|gb|AFJ53054.1| tannin-related R2R3 MYB transcription factor [Trifolium arvense] | Back alignment and taxonomy information |
|---|
| >gi|387135342|gb|AFJ53052.1| tannin-related R2R3 MYB transcription factor, partial [Trifolium occidentale] | Back alignment and taxonomy information |
|---|
| >gi|387135334|gb|AFJ53048.1| tannin-related R2R3 MYB transcription factor, partial [Trifolium repens] | Back alignment and taxonomy information |
|---|
| >gi|387135338|gb|AFJ53050.1| tannin-related R2R3 MYB transcription factor, partial [Trifolium repens] | Back alignment and taxonomy information |
|---|
| >gi|387135336|gb|AFJ53049.1| tannin-related R2R3 MYB transcription factor, partial [Trifolium repens] | Back alignment and taxonomy information |
|---|
| >gi|356545756|ref|XP_003541301.1| PREDICTED: transcription factor MYB12-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359484279|ref|XP_003633091.1| PREDICTED: transcription factor TT2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|387135332|gb|AFJ53047.1| tannin-related R2R3 MYB transcription factor, partial [Trifolium affine] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 228 | ||||||
| TAIR|locus:2169538 | 258 | TT2 "TRANSPARENT TESTA 2" [Ara | 0.684 | 0.604 | 0.329 | 1.1e-16 | |
| TAIR|locus:2038520 | 246 | MYB13 "myb domain protein 13" | 0.407 | 0.378 | 0.427 | 2.5e-16 | |
| TAIR|locus:2149000 | 336 | MYB9 "myb domain protein 9" [A | 0.241 | 0.163 | 0.6 | 4.9e-16 | |
| TAIR|locus:2121259 | 282 | MYB4 "myb domain protein 4" [A | 0.679 | 0.549 | 0.324 | 2e-15 | |
| TAIR|locus:2075387 | 321 | MYB107 "myb domain protein 107 | 0.241 | 0.171 | 0.6 | 3.3e-15 | |
| TAIR|locus:2115708 | 324 | MYB74 "myb domain protein 74" | 0.241 | 0.169 | 0.6 | 4.6e-15 | |
| TAIR|locus:2059883 | 269 | MYB7 "myb domain protein 7" [A | 0.241 | 0.204 | 0.618 | 6.9e-15 | |
| TAIR|locus:2009452 | 257 | MYB3 "myb domain protein 3" [A | 0.614 | 0.544 | 0.358 | 8.8e-15 | |
| TAIR|locus:2132584 | 266 | MYB85 "myb domain protein 85" | 0.763 | 0.654 | 0.333 | 8.8e-15 | |
| TAIR|locus:2195528 | 370 | AtMYB103 "myb domain protein 1 | 0.385 | 0.237 | 0.417 | 1.4e-14 |
| TAIR|locus:2169538 TT2 "TRANSPARENT TESTA 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 206 (77.6 bits), Expect = 1.1e-16, P = 1.1e-16
Identities = 57/173 (32%), Positives = 86/173 (49%)
Query: 1 CGKSCRLRWLNYLRPDIKRGNISHXXXXXXXXXXXXXXXXWSLIAGRLPGRTDNE----- 55
CGKSCRLRW NYLRP IKRGNIS WSLIAGRLPGRTDNE
Sbjct: 51 CGKSCRLRWKNYLRPGIKRGNISSDEEELIIRLHNLLGNRWSLIAGRLPGRTDNEIKNHW 110
Query: 56 --NMKSRIIGAPTLENKKLQDHHQSPSSSTACTRKTLN-QCQEKPKLGSKKFIAK---TD 109
N++ R+ T + K+++ H + + + C +T +C K L S + K T
Sbjct: 111 NSNLRKRLPKTQTKQPKRIK--HSTNNENNVCVIRTKAIRCS-KTLLFSDLSLQKKSSTS 167
Query: 110 SYPIRTRASKRTKALFFSTPEQE--KSYGQDQLPNLDDTDSIG-GDIVSAINT 159
P++ + + + E + + + + P+L D D + G++ S +++
Sbjct: 168 PLPLKEQEMDQGGSSLMGDLEFDFDRIHSEFHFPDLMDFDGLDCGNVTSLVSS 220
|
|
| TAIR|locus:2038520 MYB13 "myb domain protein 13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2149000 MYB9 "myb domain protein 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2121259 MYB4 "myb domain protein 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075387 MYB107 "myb domain protein 107" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115708 MYB74 "myb domain protein 74" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2059883 MYB7 "myb domain protein 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009452 MYB3 "myb domain protein 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132584 MYB85 "myb domain protein 85" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2195528 AtMYB103 "myb domain protein 103" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 228 | |||
| PLN03212 | 249 | PLN03212, PLN03212, Transcription repressor MYB5; | 5e-25 | |
| PLN03091 | 459 | PLN03091, PLN03091, hypothetical protein; Provisio | 1e-23 | |
| COG5147 | 512 | COG5147, REB1, Myb superfamily proteins, including | 8e-07 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 1e-06 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 3e-05 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 1e-04 |
| >gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
Score = 98.2 bits (244), Expect = 5e-25
Identities = 42/55 (76%), Positives = 49/55 (89%)
Query: 1 CGKSCRLRWLNYLRPDIKRGNISHDEDELIIRLLNLLANRWSLIAGRLPGRTDNE 55
CGKSCRLRW+NYLRP +KRG I+ DE++LI+RL LL NRWSLIAGR+PGRTDNE
Sbjct: 60 CGKSCRLRWMNYLRPSVKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNE 114
|
Length = 249 |
| >gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 228 | |||
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 99.95 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 99.91 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 99.89 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.41 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.33 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 99.32 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.26 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 99.24 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 99.13 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 99.12 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 99.08 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.04 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.04 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 98.78 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 98.27 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 97.63 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 97.63 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 97.52 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 97.51 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 97.35 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 97.34 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 96.88 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 96.37 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 96.23 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 96.06 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 95.97 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 95.81 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 95.65 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 93.81 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 91.89 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 88.1 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 85.93 | |
| KOG1194 | 534 | consensus Predicted DNA-binding protein, contains | 85.72 | |
| KOG2656 | 445 | consensus DNA methyltransferase 1-associated prote | 85.59 | |
| PF08281 | 54 | Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 | 83.28 |
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
Probab=99.95 E-value=2.2e-27 Score=208.91 Aligned_cols=72 Identities=68% Similarity=1.122 Sum_probs=70.5
Q ss_pred CchhhHHHhhhccCCCCCCCCCCHHHHHHHHHHHHHhcCchHHhhccCCCCChhhhhhhhccccchhhhHHhhhcC
Q 040653 1 CGKSCRLRWLNYLRPDIKRGNISHDEDELIIRLLNLLANRWSLIAGRLPGRTDNENMKSRIIGAPTLENKKLQDHH 76 (228)
Q Consensus 1 ~gKQCr~RW~n~L~P~ikk~~WT~EED~lLl~lv~~~G~kWs~IA~~LpGRTd~q~~KnR~~kw~~~l~kk~~~~~ 76 (228)
||||||+||+|||+|+|+||.||+|||++|++||..+||+|++||++|||||||+| ||+ |+++++|++....
T Consensus 44 ~GKSCRlRW~NyLrP~ikrg~fT~eEe~~Ii~lH~~~GNrWs~IA~~LPGRTDNeI-KN~---Wnt~lkkkl~~~~ 115 (238)
T KOG0048|consen 44 CGKSCRLRWTNYLRPDLKRGNFSDEEEDLIIKLHALLGNRWSLIAGRLPGRTDNEV-KNH---WNTHLKKKLLKMG 115 (238)
T ss_pred cchHHHHHhhcccCCCccCCCCCHHHHHHHHHHHHHHCcHHHHHHhhCCCcCHHHH-HHH---HHHHHHHHHHHcC
Confidence 89999999999999999999999999999999999999999999999999999999 999 9999999998776
|
|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 228 | ||||
| 1a5j_A | 110 | Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe | 1e-04 | ||
| 1h8a_C | 128 | Crystal Structure Of Ternary Protein-Dna Complex3 L | 2e-04 | ||
| 1h88_C | 159 | Crystal Structure Of Ternary Protein-Dna Complex1 L | 3e-04 | ||
| 1gv2_A | 105 | Crystal Structure Of C-Myb R2r3 Length = 105 | 3e-04 | ||
| 1mse_C | 105 | Solution Structure Of A Specific Dna Complex Of The | 3e-04 |
| >pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 | Back alignment and structure |
|
| >pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 | Back alignment and structure |
| >pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 | Back alignment and structure |
| >pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 | Back alignment and structure |
| >pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 228 | |||
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 2e-32 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 2e-30 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 2e-29 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 1e-15 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 1e-27 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 1e-04 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 8e-26 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 3e-23 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 3e-14 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 8e-09 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 3e-05 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 1e-07 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 4e-05 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 9e-05 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 4e-04 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 4e-04 |
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 | Back alignment and structure |
|---|
Score = 113 bits (286), Expect = 2e-32
Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 7/89 (7%)
Query: 1 CGKSCRLRWLNYLRPDIKRGNISHDEDELIIRLLNLLANRWSLIAGRLPGRTDNE----- 55
K CR RW N+L P + + + +EDE I R L ++WS+IA +PGRTDN
Sbjct: 36 SPKQCRERWFNHLDPAVVKHAWTPEEDETIFRNYLKLGSKWSVIAKLIPGRTDNAIKNRW 95
Query: 56 --NMKSRIIGAPTLENKKLQDHHQSPSSS 82
++ RI + L D + ++
Sbjct: 96 NSSISKRISTNSNHKEILLPDRSKKRKAA 124
|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 228 | |||
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.9 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.89 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.89 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.87 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.87 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.84 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.84 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.82 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.81 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.77 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.75 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.71 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.7 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.67 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.66 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.66 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.64 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.63 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.61 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 99.41 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.57 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.57 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.47 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.46 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.46 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.41 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 99.41 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 99.39 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.37 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.35 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 99.34 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 99.33 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 99.31 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.24 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 99.21 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 99.15 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 99.09 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 98.86 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 98.86 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 98.83 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 98.77 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 98.45 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 98.42 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 98.39 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 98.29 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 98.22 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 97.48 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 98.09 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 98.0 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.85 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 97.85 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 97.76 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 97.64 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 97.27 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 96.17 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 96.15 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 96.02 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 95.98 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 95.43 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 94.69 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 93.23 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 92.4 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 92.2 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 90.39 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 89.82 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 88.88 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 86.02 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 85.9 |
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
Probab=99.90 E-value=2e-24 Score=167.47 Aligned_cols=71 Identities=25% Similarity=0.497 Sum_probs=66.9
Q ss_pred CchhhHHHhhhccCCCCCCCCCCHHHHHHHHHHHHHhcCchHHhhccCCCCChhhhhhhhccccchhhhHHhhhc
Q 040653 1 CGKSCRLRWLNYLRPDIKRGNISHDEDELIIRLLNLLANRWSLIAGRLPGRTDNENMKSRIIGAPTLENKKLQDH 75 (228)
Q Consensus 1 ~gKQCr~RW~n~L~P~ikk~~WT~EED~lLl~lv~~~G~kWs~IA~~LpGRTd~q~~KnR~~kw~~~l~kk~~~~ 75 (228)
|++||++||.++|+|++++++||+|||++|+++|.+||++|+.||.+|||||+++| ||| |+.++++..+..
T Consensus 35 t~~qcr~Rw~~~L~p~i~~~~WT~eEd~~L~~~~~~~G~~W~~Ia~~l~gRt~~~~-k~r---w~~l~r~~~~~~ 105 (107)
T 2k9n_A 35 NPRQCRERWNNYINPALRTDPWSPEEDMLLDQKYAEYGPKWNKISKFLKNRSDNNI-RNR---WMMIARHRAKHQ 105 (107)
T ss_dssp CHHHHHHHHHHHSSSCCTTCCCCHHHHHHHHHHHHHTCSCHHHHHHHHSSSCHHHH-HHH---HHHHHHHHHSST
T ss_pred CHHHHHHHHHHHHcccccccccCHHHHHHHHHHHHHhCcCHHHHHHHCCCCCHHHH-HHH---HHHHHhhHHHhh
Confidence 68999999999999999999999999999999999999999999999999999999 999 999888765543
|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 228 | ||||
| d1gv2a2 | 47 | a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou | 5e-06 | |
| d1gvda_ | 52 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 3e-05 | |
| d1gvda_ | 52 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 4e-04 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 6e-05 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 7e-05 | |
| d1igna1 | 86 | a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba | 8e-05 | |
| d1igna1 | 86 | a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba | 1e-04 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 2e-04 | |
| d2ckxa1 | 83 | a.4.1.3 (A:578-660) Telomere binding protein TBP1 | 2e-04 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 3e-04 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 0.001 |
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: c-Myb, DNA-binding domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 40.2 bits (94), Expect = 5e-06
Identities = 16/37 (43%), Positives = 23/37 (62%)
Query: 19 RGNISHDEDELIIRLLNLLANRWSLIAGRLPGRTDNE 55
+ + + +ED +I + L NRW+ IA LPGRTDN
Sbjct: 1 KTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA 37
|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 228 | |||
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.74 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.7 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.61 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.58 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.51 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.5 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.49 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.4 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.38 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 99.3 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.3 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 99.27 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 99.26 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.25 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 98.72 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 98.15 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 98.01 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 97.87 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 97.37 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 97.23 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 96.93 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 91.02 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 87.29 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 86.4 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 83.14 |
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: c-Myb, DNA-binding domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.74 E-value=5.4e-19 Score=117.75 Aligned_cols=47 Identities=36% Similarity=0.536 Sum_probs=44.7
Q ss_pred CCCCCHHHHHHHHHHHHHhcCchHHhhccCCCCChhhhhhhhccccchhhh
Q 040653 19 RGNISHDEDELIIRLLNLLANRWSLIAGRLPGRTDNENMKSRIIGAPTLEN 69 (228)
Q Consensus 19 k~~WT~EED~lLl~lv~~~G~kWs~IA~~LpGRTd~q~~KnR~~kw~~~l~ 69 (228)
|++||+|||++|+++|.+||++|+.||.+|||||+++| ||| |+.+++
T Consensus 1 K~~WT~eED~~L~~~v~~~G~~W~~Ia~~~~gRt~~~~-knr---~~~~lr 47 (47)
T d1gv2a2 1 KTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAI-KNH---WNSTMR 47 (47)
T ss_dssp CCCCCHHHHHHHHHHHHHHSSCHHHHHTTCTTCCHHHH-HHH---HHHHTC
T ss_pred CCCCCHHHHHHHHHHHHHHhhHHHHHHhHcCCCCHHHH-HHH---HHHHcC
Confidence 67999999999999999999999999999999999999 999 888764
|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|