Citrus Sinensis ID: 040660

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------

MGLQQSKEELLYQQVNYGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTLIELGAKVDAYRPGRHGGTPLHHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKGFTNVVRAIENHICIFSGWLRELYGPGFLELLAPQLLSRKVWVAVLPTGSRNPTKPFKLELAIYPSLLDARPRMVIALWKANLEEPKFQHSDPSVTIVDNSTIPRGRRRRRRCRTQIIRQTRIKLAAANESDKQQLQAFCNACKGIPQVNPAFLHNPQSHAVQATAPTPAEDLELAMAINASIQTAIAETPICDPQPSSGATAASTSWNNSGQGASAAPSPSKASSSQWVMHEARLSGHSSQQTQIQNNNMPATKTMIHSLDTIPSAPPVTDEITEDGPVQYPSIDVGPVDVSSPSIEQLPCSKSKVKGDKDATSSCVICLDAPVEGACVPCGHMAGCMSCLNEVKAKKWGCPVCRANISQVIRLYAV

ccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHccccHHHHHHHHHccccccccccccccccHHHHHHHHcHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHccccccHHHHHHHcccccccccccccccHHHcHHHHcccHHHHHHHHHccccccccccccccEEEEcccccHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccEEEEEcccccEEECccccHHHHHHHHHHHHHccccccccccccccEEEEEEc

MG*QQSKEELLYQQVNYGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTLIELGAKVDAYRPGRHGGTPLHHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKGFTNVVRAIENHICIFSGWLRELYGPGFLELLAPQLLSRKVWVAVLPTGSRNPTKPFKLELAIYPSLLDARPRMVIALWKANLEEPKFQHSDPSVTIVDNSTIPRGRRRRRRCRTQIIRQTRIKLAAANESDKQQLQAFCNACKGIPQVNPAFLH******************ELAMAINASIQTAIA************************************************************************************EITEDGPVQYPSIDVGPV*************************SCVICLDAPVEGACVPCGHMAGCMSCLNEVKAKKWGCPVCRANISQVIRLYAV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Putative E3 ubiquitin-protein ligase XBAT35	No E3 ubiquitin-protein ligase activity observed when associated with the E2 enzyme UBC8 in vitro.	probable	Q4FE47
Probable E3 ubiquitin-protein ligase XBOS34		probable	Q7XI08

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 8-216
View the alignment between query and template
View the model in PyMOL

Template: 2VJE, chain B
Confidence level:confident
Coverage over the Query: 432-486
View the alignment between query and template
View the model in PyMOL

Template: 4AYC, chain B
Confidence level:probable
Coverage over the Query: 433-478
View the alignment between query and template
View the model in PyMOL

Template: 1QZV, chain F
Confidence level:probable
Coverage over the Query: 274-303
View the alignment between query and template
View the model in PyMOL