Citrus Sinensis ID: 040660


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------
MGLQQSKEELLYQQVNYGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTLIELGAKVDAYRPGRHGGTPLHHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKGFTNVVRAIENHICIFSGWLRELYGPGFLELLAPQLLSRKVWVAVLPTGSRNPTKPFKLELAIYPSLLDARPRMVIALWKANLEEPKFQHSDPSVTIVDNSTIPRGRRRRRRCRTQIIRQTRIKLAAANESDKQQLQAFCNACKGIPQVNPAFLHNPQSHAVQATAPTPAEDLELAMAINASIQTAIAETPICDPQPSSGATAASTSWNNSGQGASAAPSPSKASSSQWVMHEARLSGHSSQQTQIQNNNMPATKTMIHSLDTIPSAPPVTDEITEDGPVQYPSIDVGPVDVSSPSIEQLPCSKSKVKGDKDATSSCVICLDAPVEGACVPCGHMAGCMSCLNEVKAKKWGCPVCRANISQVIRLYAV
ccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHccccHHHHHHHHHccccccccccccccccHHHHHHHHcHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHccccccHHHHHHHcccccccccccccccHHHcHHHHcccHHHHHHHHHccccccccccccccEEEEccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccEEEEEcccccEEEEccccHHHHHHHHHHHHHccccccccccccccEEEEEEc
cccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHccccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHccccHHHHHHHHHHHccccHccccHHHHHHcccccccHcccccccccHccccEHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccEEEEEEcccccEEEcccccHHHHHHHHHHHHHcccccccEEEcEcEEEEEEEc
MGLQQSKEELLYQQVNYGNVEGIKALCRdgaglewidkegktpliaacmnpglYDVAKTLIELGAkvdayrpgrhggtplhhAAKRGLERTVKLLLSYGAnalvlnddcqtplevaraKGFTNVVRAIENHICIFSgwlrelygpgflelLAPQLLSRKVWVAVlptgsrnptkpfklELAIYPSLLDARPRMVIALWKAnleepkfqhsdpsvtivdnstiprgrrrrRRCRTQIIRQTRIKLAAANESDKQQLQAFCNAckgipqvnpaflhnpqshavqataptpaeDLELAMAINASIQTAIaetpicdpqpssgataastswnnsgqgasaapspskasssqwvmhearlsghssqqtqiqnnnmpatktmihsldtipsappvtdeitedgpvqypsidvgpvdvsspsieqlpcskskvkgdkdatsscvicldapvegacvpcghmagcmsclnevkakkwgcpvcranISQVIRLYAV
MGLQQSKEELLYQQVNYGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTLIELGAKVDAYRPGRHGGTPLHHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKGFTNVVRAIENHICIFSGWLRELYGPGFLELLAPQLLSRKVWVAVLPtgsrnptkpfklELAIYPSLLDARPRMVIALWKANLEepkfqhsdpsvtivdnstiprgrrrrrrcrtqiirqtriklaaaneSDKQQLQAFCNACKGIPQVNPAFLHNPQSHAVQATAPTPAEDLELAMAINASIQTAIAETPICDPQPSSGATAASTSWNNSGQGASAAPSPSKASSSQWVMHEARLSGHSSQQTQIQNNNMPATKTMIHSLDTIPSAPPVTDEITEDGPVQYPSIDVGPVDVSSPSIEQLpcskskvkgdkdaTSSCVICLDAPVEGACVPCGHMAGCMSCLNEVKakkwgcpvcranisqvirlyav
MGLQQSKEELLYQQVNYGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTLIELGAKVDAYRPGRHGGTPLHHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKGFTNVVRAIENHICIFSGWLRELYGPGFLELLAPQLLSRKVWVAVLPTGSRNPTKPFKLELAIYPSLLDARPRMVIALWKANLEEPKFQHSDPSVTIVDNStiprgrrrrrrcrtqiirqtriKLAAANESDKQQLQAFCNACKGIPQVNPAFLHNPQSHAVQATAPTPAEDLELAMAINASIQTAIAETPICDPQPSSGATAASTSWNNsgqgasaapspskasssqWVMHEARLSGHSSQQTQIQNNNMPATKTMIHSLDTIPSAPPVTDEITEDGPVQYPSIDVGPVDVSSPSIEQLPCSKSKVKGDKDATSSCVICLDAPVEGACVPCGHMAGCMSCLNEVKAKKWGCPVCRANISQVIRLYAV
*********LLYQQVNYGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTLIELGAKVDAYRPGRHGGTPLHHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKGFTNVVRAIENHICIFSGWLRELYGPGFLELLAPQLLSRKVWVAVLPTGSRNPTKPFKLELAIYPSLLDARPRMVIALWKANLE****************************CRTQIIRQTRIKLAAA******QLQAFCNACKGIPQVNPAFLH******************ELAMAINASIQTAIA*******************************************************************************************************************************SCVICLDAPVEGACV**************************************
MG*QQSKEELLYQQVNYGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTLIELGAKVDAYRPGRHGGTPLHHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKGFTNVVRAIENHICIFSGWLRELYGPGFLELLAPQLLSRKVWVAVLPTGSRNPTKPFKLELAIYPSLLDARPRMVIALWKANLEEPKFQHSDPSVTIVDNSTIPRGRRRRRRCRTQIIRQTRIKLAAANESDKQQLQAFCNACKGIPQVNPAFLH*********************************************************************************************************************EITEDGPVQYPSIDVGPV***************************VICLDAPVEGACVPCGHMAGCMSCLNEVKAKKWGCPVCRANISQVIRLYAV
MGLQQSKEELLYQQVNYGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTLIELGAKVDAYRPGRHGGTPLHHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKGFTNVVRAIENHICIFSGWLRELYGPGFLELLAPQLLSRKVWVAVLPTGSRNPTKPFKLELAIYPSLLDARPRMVIALWKANLEEPKFQHSDPSVTIVDNST********RRCRTQIIRQTRIKLAAANESDKQQLQAFCNACKGIPQVNPAFLHNPQSHAVQATAPTPAEDLELAMAINASIQTAIAETPICD***********************************VMHEA***********IQNNNMPATKTMIHSLDTIPSAPPVTDEITEDGPVQYPSIDVGPVDVSSPSIEQLP*************SSCVICLDAPVEGACVPCGHMAGCMSCLNEVKAKKWGCPVCRANISQVIRLYAV
******KEELLYQQVNYGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTLIELGAKVDAYRPGRHGGTPLHHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKGFTNVVRAIENHICIFSGWLRELYGPGFLELLAPQLLSRKVWVAVLPTGSRNPTKPFKLELAIYPSLLDARPRMVIALWKANLEEPKFQHSDPSVTIVDNSTIPRGRRRRRRCRTQIIRQTRIKLAAANESDKQQLQAFCNACKGIPQVNPAFLHNPQSHAVQATAPTPAEDLELAMAINASIQTAIAETPICDP*******************************************************M*ATKT*****DTIPSAPPVTDEITEDGPVQYPSIDVGPVDVSSPS*****************TSSCVICLDAPVEGACVPCGHMAGCMSCLNEVKAKKWGCPVCRANISQVIRLYAV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLQQSKEELLYQQVNYGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTLIELGAKVDAYRPGRHGGTPLHHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKGFTNVVRAIENHICIFSGWLRELYGPGFLELLAPQLLSRKVWVAVLPTGSRNPTKPFKLELAIYPSLLDARPRMVIALWKANLEEPKFQHSDPSVTIVDNSTIPRGRRRRRRCRTQIIRQTRIKLAAANESDKQQLQAFCNACKGIPQVNPAFLHNPQSHAVQATAPTPAEDLELAMAINASIQTAIAETPICDPQPSSGATAASTSWNNSGQGASAAPSPSKASSSQWVMHEARLSGHSSQQTQIQNNNMPATKTMIHSLDTIPSAPPVTDEITEDGPVQYPSIDVGPVDVSSPSIEQLPCSKSKVKGDKDATSSCVICLDAPVEGACVPCGHMAGCMSCLNEVKAKKWGCPVCRANISQVIRLYAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query487 2.2.26 [Sep-21-2011]
Q4FE47462 Putative E3 ubiquitin-pro yes no 0.928 0.978 0.579 1e-153
Q7XI08513 Probable E3 ubiquitin-pro yes no 0.958 0.910 0.508 1e-135
Q9FPH0376 Putative E3 ubiquitin-pro no no 0.640 0.829 0.572 1e-95
Q6UB99 2663 Ankyrin repeat domain-con yes no 0.236 0.043 0.406 5e-12
Q9SAR5342 Ankyrin repeat domain-con no no 0.240 0.342 0.375 2e-11
O75179 2603 Ankyrin repeat domain-con no no 0.227 0.042 0.362 8e-09
Q99NH0 2603 Ankyrin repeat domain-con no no 0.227 0.042 0.362 9e-09
Q6UB98 2062 Ankyrin repeat domain-con no no 0.217 0.051 0.412 9e-09
Q53RE8183 Ankyrin repeat domain-con no no 0.262 0.699 0.330 1e-08
Q9J4Z4592 Putative ankyrin repeat p N/A no 0.160 0.131 0.457 1e-08
>sp|Q4FE47|XB35_ARATH Putative E3 ubiquitin-protein ligase XBAT35 OS=Arabidopsis thaliana GN=XBAT35 PE=2 SV=1 Back     alignment and function desciption
 Score =  543 bits (1399), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 288/497 (57%), Positives = 348/497 (70%), Gaps = 45/497 (9%)

Query: 1   MGLQQSKEELLYQQVNYGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTL 60
           MG QQSK ELLYQQV+YGN EGI+AL RDG  LEW+D+EGKTPLI ACMN  L+DVAKTL
Sbjct: 1   MGQQQSKGELLYQQVSYGNSEGIRALHRDGGDLEWMDREGKTPLILACMNSELFDVAKTL 60

Query: 61  IELGAKVDAYRPGRHGGTPLHHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKG 120
           IELG+ V+AYRPGRH GTPLHHAAKRGLE TVKLLLS+GAN LVLNDDCQTPLEVAR KG
Sbjct: 61  IELGSNVNAYRPGRHAGTPLHHAAKRGLENTVKLLLSHGANPLVLNDDCQTPLEVARVKG 120

Query: 121 FTNVVRAIENHICIFSGWLRELYGPGFLELLAPQLLSRKVWVAVLPTGSRNPTKPFKLEL 180
           F+NVVRAIE HIC+FSGW+RE YGP FL+L APQLLSR+VWV ++PTGSRNPTKPFKLEL
Sbjct: 121 FSNVVRAIEKHICLFSGWMREFYGPTFLDLFAPQLLSRRVWVVIVPTGSRNPTKPFKLEL 180

Query: 181 AIYPSLLDARPRMVIALWKANLEEPKFQHSDPSVTIVDNSTIPRGRRRRRRC-------R 233
            +Y SL DA+PR V+ LWKANLEEPK + SD SV IVDNSTIP  R ++RR        R
Sbjct: 181 VVYASLQDAQPRTVMPLWKANLEEPKAKQSDTSVMIVDNSTIPSRRMKKRRVCASHGRRR 240

Query: 234 TQIIRQTRIKLAAANESDKQQLQAFCNACKGIPQVNPAFLHNPQSHAVQATAPTPAEDLE 293
            Q++RQTR+K A + E D QQL+ FC+ACKGIPQ     +H P       +AP P  +  
Sbjct: 241 PQVVRQTRLKFAPSTEGDSQQLKWFCDACKGIPQP----MHPPVFLQAPPSAPPPPSEDG 296

Query: 294 LAMAINASIQTAIAETPICDPQPSSGATAASTSWNNSGQGASAAPSPSKASSSQWVMHEA 353
           LAM +NAS+ T ++     DP        ++ + ++ GQ +S++     +SS+     +A
Sbjct: 297 LAMGMNASLHTTMS-----DP--------SNLNHHSIGQASSSS---GPSSSTAPPSGKA 340

Query: 354 RLSGHSSQQTQIQNNNMPATKTMIHSLDTIPSAPPVTDE---ITEDGPVQYPSIDVGPVD 410
              G +S    I              L++ PSAPP+TD+     +DGP+ YPSID  PVD
Sbjct: 341 SAFGFNSHGIGI-------------VLESSPSAPPLTDDDIATVDDGPIHYPSIDSTPVD 387

Query: 411 VSSPSIEQLPCSKSKVKGDKDATSSCVICLDAPVEGACVPCGHMAGCMSCLNEVKAKKWG 470
           +  PS   LP S    + +   T +C ICLDAP E  CVPCGH+AGCMSCL E+K+K WG
Sbjct: 388 L--PSAASLPASTEGERKEDGNTGTCAICLDAPSEAVCVPCGHVAGCMSCLKEIKSKNWG 445

Query: 471 CPVCRANISQVIRLYAV 487
           CPVCRA I QVI+LY V
Sbjct: 446 CPVCRAKIDQVIKLYRV 462




No E3 ubiquitin-protein ligase activity observed when associated with the E2 enzyme UBC8 in vitro.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q7XI08|XB34_ORYSJ Probable E3 ubiquitin-protein ligase XBOS34 OS=Oryza sativa subsp. japonica GN=XBOS34 PE=2 SV=1 Back     alignment and function description
>sp|Q9FPH0|XB34_ARATH Putative E3 ubiquitin-protein ligase XBAT34 OS=Arabidopsis thaliana GN=XBAT34 PE=2 SV=1 Back     alignment and function description
>sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 Back     alignment and function description
>sp|Q9SAR5|AKR2_ARATH Ankyrin repeat domain-containing protein 2 OS=Arabidopsis thaliana GN=AKR2 PE=1 SV=2 Back     alignment and function description
>sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 Back     alignment and function description
>sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 Back     alignment and function description
>sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 Back     alignment and function description
>sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 Back     alignment and function description
>sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query487
224099913442 predicted protein [Populus trichocarpa] 0.903 0.995 0.652 1e-173
147799985500 hypothetical protein VITISV_013890 [Viti 0.983 0.958 0.647 1e-172
224112583444 predicted protein [Populus trichocarpa] 0.907 0.995 0.635 1e-171
449520633459 PREDICTED: putative E3 ubiquitin-protein 0.938 0.995 0.611 1e-165
449432546459 PREDICTED: putative E3 ubiquitin-protein 0.938 0.995 0.611 1e-165
18403707462 putative E3 ubiquitin-protein ligase XBA 0.928 0.978 0.579 1e-152
224101655455 predicted protein [Populus trichocarpa] 0.911 0.975 0.584 1e-151
21593715462 unknown [Arabidopsis thaliana] 0.928 0.978 0.579 1e-151
297831072462 zinc finger family protein [Arabidopsis 0.924 0.974 0.571 1e-151
30686999438 putative E3 ubiquitin-protein ligase XBA 0.893 0.993 0.567 1e-144
>gi|224099913|ref|XP_002311673.1| predicted protein [Populus trichocarpa] gi|222851493|gb|EEE89040.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  613 bits (1582), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 319/489 (65%), Positives = 371/489 (75%), Gaps = 49/489 (10%)

Query: 1   MGLQQSKEELLYQQVNYGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTL 60
           MG QQSK+ELLYQQVNYGN+ GIK LC  GAGLEWIDKEGKTPLI AC+NP L+DVA+TL
Sbjct: 1   MGQQQSKDELLYQQVNYGNIGGIKTLCSQGAGLEWIDKEGKTPLILACLNPQLFDVAQTL 60

Query: 61  IELGAKVDAYRPGRHGGTPLHHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKG 120
           IELGA VDAYRPGR+ GTPLHHAAKRGLE TVKLLLS GANALV NDDCQTPL+VARAKG
Sbjct: 61  IELGANVDAYRPGRNAGTPLHHAAKRGLENTVKLLLSRGANALVTNDDCQTPLQVARAKG 120

Query: 121 FTNVVRAIENHICIFSGWLRELYGPGFLELLAPQLLSRKVWVAVLPTGSRNPTKPFKLEL 180
            + VVRAIE+HIC+FSGWLRE YGPGFLE+LAP+L+SR VWV VLPTGSRNP +P+KLEL
Sbjct: 121 HSIVVRAIESHICLFSGWLREFYGPGFLEVLAPRLVSRDVWVVVLPTGSRNPRRPYKLEL 180

Query: 181 AIYPSLLDARPRMVIALWKANLEEPKFQHSDPSVTIVDNSTIPRGRRRRRRCRTQIIRQT 240
           AIY  L DA+PR ++ALWKANLEE KF HSDPSV IVDNST                 +T
Sbjct: 181 AIYSRLQDAQPRTIVALWKANLEEMKFHHSDPSVMIVDNST-----------------KT 223

Query: 241 RIKLAAANESDKQQLQAFCNACKGIPQVN--PAFLHNPQSHAVQATAPTPAEDLELAMAI 298
           +IKLA ANESDKQQLQ FC+ACKGI QV   PAFLHN Q+ AVQATAP  AED+E+AMA+
Sbjct: 224 QIKLAPANESDKQQLQWFCDACKGIQQVMHPPAFLHNSQAPAVQATAPPSAEDIEIAMAM 283

Query: 299 NASIQTAIAETPICDPQPSSGATAASTSWNNSGQGASAAPSPSKASSSQWVMHEARLSGH 358
           NA IQ+A AE PI DP  S+GA+++++                              +  
Sbjct: 284 NAYIQSA-AERPIFDPHSSAGASSSTSW----------------------------TTSS 314

Query: 359 SSQQTQIQNNNMPATKTMIHSLDTIPSAPPVTDEITEDGPVQYPSIDVGPVDVSSPSIEQ 418
           S+QQT+IQN+++   +T   + D++PSAPP+ DEI EDGP+ YPSID  P+D SS S+E 
Sbjct: 315 STQQTKIQNSSIADVQTATDAQDSVPSAPPIVDEIVEDGPIHYPSIDSSPIDTSSLSVEN 374

Query: 419 LPCSKSKVKGDKDATSSCVICLDAPVEGACVPCGHMAGCMSCLNEVKAKKWGCPVCRANI 478
           LP   +  K +   +SSCVICLDA VEGAC+PCGHMAGCMSCL E+KAKKWGCPVCRA I
Sbjct: 375 LP-ENTGEKREDGGSSSCVICLDALVEGACIPCGHMAGCMSCLKEIKAKKWGCPVCRAKI 433

Query: 479 SQVIRLYAV 487
            QV+RLYAV
Sbjct: 434 DQVVRLYAV 442




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147799985|emb|CAN72662.1| hypothetical protein VITISV_013890 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224112583|ref|XP_002332748.1| predicted protein [Populus trichocarpa] gi|222833076|gb|EEE71553.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449520633|ref|XP_004167338.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449432546|ref|XP_004134060.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18403707|ref|NP_566724.1| putative E3 ubiquitin-protein ligase XBAT35 [Arabidopsis thaliana] gi|122233562|sp|Q4FE47.1|XB35_ARATH RecName: Full=Putative E3 ubiquitin-protein ligase XBAT35; AltName: Full=Ankyrin repeat domain and RING finger-containing protein XBAT35; AltName: Full=Protein XB3 homolog 5 gi|70905085|gb|AAZ14068.1| At3g23280 [Arabidopsis thaliana] gi|332643225|gb|AEE76746.1| putative E3 ubiquitin-protein ligase XBAT35 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224101655|ref|XP_002334259.1| predicted protein [Populus trichocarpa] gi|222870334|gb|EEF07465.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|21593715|gb|AAM65682.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297831072|ref|XP_002883418.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297329258|gb|EFH59677.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30686999|ref|NP_850628.1| putative E3 ubiquitin-protein ligase XBAT35 [Arabidopsis thaliana] gi|15010672|gb|AAK73995.1| AT3g23280/K14B15_17 [Arabidopsis thaliana] gi|16974317|gb|AAL31143.1| AT3g23280/K14B15_17 [Arabidopsis thaliana] gi|332643226|gb|AEE76747.1| putative E3 ubiquitin-protein ligase XBAT35 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query487
TAIR|locus:2086263462 XBAT35 "XB3 ortholog 5 in Arab 0.620 0.653 0.646 4.5e-137
TAIR|locus:505006458376 XBAT34 "XB3 ortholog 4 in Arab 0.640 0.829 0.544 3.2e-104
TAIR|locus:2827572344 AKR2B "ankyrin repeat-containi 0.250 0.354 0.352 6.4e-11
UNIPROTKB|I3LPC2444 ANKRD11 "Uncharacterized prote 0.236 0.259 0.406 1.3e-10
DICTYBASE|DDB_G0276013748 DDB_G0276013 "cyclin-like F-bo 0.260 0.169 0.358 1.9e-10
ZFIN|ZDB-GENE-050628-1999 mib2 "mind bomb 2" [Danio reri 0.279 0.136 0.290 6.4e-10
UNIPROTKB|Q53RE8183 ANKRD39 "Ankyrin repeat domain 0.262 0.699 0.330 8.8e-10
RGD|1306679 2630 Ankrd11 "ankyrin repeat domain 0.236 0.043 0.398 2.6e-09
RGD|1310118345 Ankrd12 "ankyrin repeat domain 0.223 0.315 0.401 4.3e-09
UNIPROTKB|E1BAT5 2599 ANKRD11 "Uncharacterized prote 0.236 0.044 0.406 5.1e-09
TAIR|locus:2086263 XBAT35 "XB3 ortholog 5 in Arabidopsis thaliana" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1013 (361.7 bits), Expect = 4.5e-137, Sum P(2) = 4.5e-137
 Identities = 205/317 (64%), Positives = 233/317 (73%)

Query:     1 MGLQQSKEELLYQQVNYGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTL 60
             MG QQSK ELLYQQV+YGN EGI+AL RDG  LEW+D+EGKTPLI ACMN  L+DVAKTL
Sbjct:     1 MGQQQSKGELLYQQVSYGNSEGIRALHRDGGDLEWMDREGKTPLILACMNSELFDVAKTL 60

Query:    61 IELGAKVDAYRPGRHGGTPLHHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKG 120
             IELG+ V+AYRPGRH GTPLHHAAKRGLE TVKLLLS+GAN LVLNDDCQTPLEVAR KG
Sbjct:    61 IELGSNVNAYRPGRHAGTPLHHAAKRGLENTVKLLLSHGANPLVLNDDCQTPLEVARVKG 120

Query:   121 FTNVVRAIENHICIFSGWLRELYGPGFLELLAPQLLSRKVWVAVLPTGSRNPTKPFKLEL 180
             F+NVVRAIE HIC+FSGW+RE YGP FL+L APQLLSR+VWV ++PTGSRNPTKPFKLEL
Sbjct:   121 FSNVVRAIEKHICLFSGWMREFYGPTFLDLFAPQLLSRRVWVVIVPTGSRNPTKPFKLEL 180

Query:   181 AIYPSLLDARPRMVIALWKANLEEPKFQHSDPSVTIVDNSXXXXXXXXXXXXXXXXXXX- 239
              +Y SL DA+PR V+ LWKANLEEPK + SD SV IVDNS                    
Sbjct:   181 VVYASLQDAQPRTVMPLWKANLEEPKAKQSDTSVMIVDNSTIPSRRMKKRRVCASHGRRR 240

Query:   240 ------XXXKLAAANESDKQQLQAFCNACKGIPQVN--PAFLHNPQSHAVQATAPTPAED 291
                      K A + E D QQL+ FC+ACKGIPQ    P FL  P S       P P+ED
Sbjct:   241 PQVVRQTRLKFAPSTEGDSQQLKWFCDACKGIPQPMHPPVFLQAPPS-----APPPPSED 295

Query:   292 LELAMAINASIQTAIAE 308
               LAM +NAS+ T +++
Sbjct:   296 -GLAMGMNASLHTTMSD 311


GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
TAIR|locus:505006458 XBAT34 "XB3 ortholog 4 in Arabidopsis thaliana" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827572 AKR2B "ankyrin repeat-containing 2B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|I3LPC2 ANKRD11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0276013 DDB_G0276013 "cyclin-like F-box containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050628-1 mib2 "mind bomb 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q53RE8 ANKRD39 "Ankyrin repeat domain-containing protein 39" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1306679 Ankrd11 "ankyrin repeat domain 11" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1310118 Ankrd12 "ankyrin repeat domain 12" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BAT5 ANKRD11 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q4FE47XB35_ARATH6, ., 3, ., 2, ., -0.57940.92810.9783yesno
Q7XI08XB34_ORYSJ6, ., 3, ., 2, ., -0.50840.95890.9103yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query487
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-23
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-20
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-16
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-14
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 4e-13
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 5e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-12
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 2e-12
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-08
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 6e-08
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-07
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-07
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-07
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 5e-07
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 8e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-06
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 5e-06
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 5e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-06
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 1e-05
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-05
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-05
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 8e-05
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-04
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 2e-04
smart0024830 smart00248, ANK, ankyrin repeats 3e-04
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-04
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 5e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 8e-04
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.001
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.001
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.003
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 0.004
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 94.0 bits (234), Expect = 5e-23
 Identities = 44/114 (38%), Positives = 65/114 (57%), Gaps = 3/114 (2%)

Query: 15  VNYGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTLIELGAKVDAYRPGR 74
            + G++E +K L  +GA +   D +G+TPL  A  N G  ++ K L+E GA V+A    +
Sbjct: 15  ASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKN-GHLEIVKLLLEKGADVNA--RDK 71

Query: 75  HGGTPLHHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKGFTNVVRAI 128
            G TPLH AA+ G    VKLLL +GA+    + D +TPL +A   G   VV+ +
Sbjct: 72  DGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHLEVVKLL 125


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 487
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 99.97
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.97
PHA02791284 ankyrin-like protein; Provisional 99.97
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02874434 ankyrin repeat protein; Provisional 99.96
PHA02878477 ankyrin repeat protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02875413 ankyrin repeat protein; Provisional 99.95
PHA03100480 ankyrin repeat protein; Provisional 99.95
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.95
PHA02946446 ankyin-like protein; Provisional 99.95
PHA02878477 ankyrin repeat protein; Provisional 99.95
PHA02875413 ankyrin repeat protein; Provisional 99.94
PHA02874434 ankyrin repeat protein; Provisional 99.94
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.94
PHA03100480 ankyrin repeat protein; Provisional 99.94
PHA02859209 ankyrin repeat protein; Provisional 99.94
KOG0508615 consensus Ankyrin repeat protein [General function 99.94
KOG0514452 consensus Ankyrin repeat protein [General function 99.94
KOG0508615 consensus Ankyrin repeat protein [General function 99.94
PHA02946446 ankyin-like protein; Provisional 99.94
PHA02798489 ankyrin-like protein; Provisional 99.93
PHA03095471 ankyrin-like protein; Provisional 99.93
PHA02795437 ankyrin-like protein; Provisional 99.93
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.93
KOG0510 929 consensus Ankyrin repeat protein [General function 99.93
PHA03095471 ankyrin-like protein; Provisional 99.93
PHA02876682 ankyrin repeat protein; Provisional 99.93
PHA02876682 ankyrin repeat protein; Provisional 99.93
PHA02798489 ankyrin-like protein; Provisional 99.92
KOG0510 929 consensus Ankyrin repeat protein [General function 99.92
PLN03192823 Voltage-dependent potassium channel; Provisional 99.92
PHA02989494 ankyrin repeat protein; Provisional 99.91
PHA02989494 ankyrin repeat protein; Provisional 99.91
PHA02917 661 ankyrin-like protein; Provisional 99.91
PHA02743166 Viral ankyrin protein; Provisional 99.91
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.9
PHA02741169 hypothetical protein; Provisional 99.89
PHA02730 672 ankyrin-like protein; Provisional 99.89
PHA02884300 ankyrin repeat protein; Provisional 99.89
PHA02795437 ankyrin-like protein; Provisional 99.88
PHA02743166 Viral ankyrin protein; Provisional 99.88
PLN03192823 Voltage-dependent potassium channel; Provisional 99.88
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.88
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.88
PHA02736154 Viral ankyrin protein; Provisional 99.87
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.87
PHA02917661 ankyrin-like protein; Provisional 99.87
PHA02741169 hypothetical protein; Provisional 99.87
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.86
PHA02730672 ankyrin-like protein; Provisional 99.86
KOG0514452 consensus Ankyrin repeat protein [General function 99.84
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.84
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.84
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.84
PHA02736154 Viral ankyrin protein; Provisional 99.84
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.83
PHA02792631 ankyrin-like protein; Provisional 99.83
PHA02884300 ankyrin repeat protein; Provisional 99.82
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.81
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.8
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.79
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.79
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.78
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.78
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.76
PHA02792631 ankyrin-like protein; Provisional 99.76
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.76
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.76
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.73
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.72
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.67
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.65
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.64
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.64
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.63
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.63
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.59
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.54
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.54
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 99.52
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.52
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.49
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.47
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.46
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.43
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.43
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.42
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.31
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 99.18
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 99.18
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.1
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.03
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.01
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.95
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.94
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.94
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.92
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.86
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.85
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 98.83
PHA02929238 N1R/p28-like protein; Provisional 98.83
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.82
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.82
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.81
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.81
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.79
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.78
PF1360630 Ank_3: Ankyrin repeat 98.74
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.73
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.69
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.66
PF1360630 Ank_3: Ankyrin repeat 98.65
KOG0522560 consensus Ankyrin repeat protein [General function 98.62
PHA02926242 zinc finger-like protein; Provisional 98.58
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.58
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.56
PF1463444 zf-RING_5: zinc-RING finger domain 98.55
KOG0522560 consensus Ankyrin repeat protein [General function 98.55
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.51
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.44
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.43
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.43
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.4
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.33
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.32
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.31
KOG2384223 consensus Major histocompatibility complex protein 98.29
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.28
KOG0520975 consensus Uncharacterized conserved protein, conta 98.28
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.27
KOG0511516 consensus Ankyrin repeat protein [General function 98.22
KOG2384223 consensus Major histocompatibility complex protein 98.22
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.21
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.19
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.12
KOG0511516 consensus Ankyrin repeat protein [General function 98.1
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.1
KOG0520975 consensus Uncharacterized conserved protein, conta 98.08
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.97
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.95
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.92
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.92
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.87
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 97.84
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.8
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 97.77
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.7
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.59
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.59
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.41
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.39
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.36
COG5236 493 Uncharacterized conserved protein, contains RING Z 97.33
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.28
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 97.27
COG5152259 Uncharacterized conserved protein, contains RING a 97.21
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.01
KOG2505591 consensus Ankyrin repeat protein [General function 96.94
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.91
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.87
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.8
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 96.62
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.58
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 96.49
KOG2505591 consensus Ankyrin repeat protein [General function 96.32
KOG3002 299 consensus Zn finger protein [General function pred 96.18
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.05
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.99
KOG0825 1134 consensus PHD Zn-finger protein [General function 95.94
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 95.86
COG5175 480 MOT2 Transcriptional repressor [Transcription] 95.81
PF04641260 Rtf2: Rtf2 RING-finger 95.73
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 95.59
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.47
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.46
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 95.4
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.4
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 95.24
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 95.16
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.11
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 95.06
KOG2660 331 consensus Locus-specific chromosome binding protei 94.99
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 94.95
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 94.81
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 94.78
KOG1002 791 consensus Nucleotide excision repair protein RAD16 94.74
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 94.09
COG52191525 Uncharacterized conserved protein, contains RING Z 93.8
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 93.76
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 93.67
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 93.66
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 93.63
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 92.7
KOG2113394 consensus Predicted RNA binding protein, contains 91.87
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 91.81
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 91.69
PF10272358 Tmpp129: Putative transmembrane protein precursor; 91.01
PF04710416 Pellino: Pellino; InterPro: IPR006800 Pellino is i 90.95
COG5222427 Uncharacterized conserved protein, contains RING Z 90.61
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 89.23
KOG3842429 consensus Adaptor protein Pellino [Signal transduc 88.59
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 88.55
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 87.68
PHA02862156 5L protein; Provisional 86.5
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 86.44
PHA02825162 LAP/PHD finger-like protein; Provisional 86.3
KOG149384 consensus Anaphase-promoting complex (APC), subuni 84.72
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 84.0
KOG1941518 consensus Acetylcholine receptor-associated protei 83.43
PHA03096284 p28-like protein; Provisional 83.24
KOG2113 394 consensus Predicted RNA binding protein, contains 83.19
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 81.11
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=1.2e-34  Score=244.52  Aligned_cols=168  Identities=29%  Similarity=0.265  Sum_probs=159.8

Q ss_pred             CCCCchHHHHHHHHcCCHHHHHHHHHc-CCCCCccCCCCChHHHHHHhCCCcHHHHHHHHHc-CCCccccCCCCCCCcHH
Q 040660            3 LQQSKEELLYQQVNYGNVEGIKALCRD-GAGLEWIDKEGKTPLIAACMNPGLYDVAKTLIEL-GAKVDAYRPGRHGGTPL   80 (487)
Q Consensus         3 ~d~~g~t~L~~Aa~~g~~~~v~~Ll~~-g~~~~~~d~~G~TpL~~A~~~~g~~~~v~~Ll~~-ga~~~~~~~d~~g~TpL   80 (487)
                      .|++|+|||||||..|+.++|.+|++. +..+|.+|..|+||||+||.. |+.++|+.|+.+ |+++|+.  +..|.|+|
T Consensus        34 ~dqD~Rt~LHwa~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~-g~~evVk~Ll~r~~advna~--tn~G~T~L  110 (226)
T KOG4412|consen   34 DDQDGRTPLHWACSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASN-GNDEVVKELLNRSGADVNAT--TNGGQTCL  110 (226)
T ss_pred             ccccCCceeeeeeecCchhHHHHHHhcCCCCCCCccccCCchhhhhhhc-CcHHHHHHHhcCCCCCccee--cCCCccee
Confidence            467999999999999999999999954 888999999999999999999 999999999998 9999998  99999999


Q ss_pred             HHHHHhCCHHHHHHHHHcCCCcccccCCCCCHHHHHHHcCCHHHHHHHHhCCCcccccccccCCCCHHHHHhhhcCCHHH
Q 040660           81 HHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKGFTNVVRAIENHICIFSGWLRELYGPGFLELLAPQLLSRKV  160 (487)
Q Consensus        81 h~Aa~~g~~~~v~~Ll~~ga~~~~~d~~g~TpL~~A~~~g~~~~v~~Ll~~ga~~~~~~~d~~G~t~L~~~a~~~~~~~~  160 (487)
                      |||+..|..+++++|++.|+.++++|..|.||||-|+.-|.++++++|+..|+.+|  .+|++|.|||| .|...++.++
T Consensus       111 HyAagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAAavGklkvie~Li~~~a~~n--~qDk~G~TpL~-~al~e~~~d~  187 (226)
T KOG4412|consen  111 HYAAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAAVGKLKVIEYLISQGAPLN--TQDKYGFTPLH-HALAEGHPDV  187 (226)
T ss_pred             hhhhcCChhhHHHHHHhcCCCCcccccccCchhHHHHhccchhhHHHHHhcCCCCC--cccccCccHHH-HHHhccCchH
Confidence            99999999999999999999999999999999999999999999999999999999  99999999999 7777789999


Q ss_pred             HHHhhcCCCCCCCCCC
Q 040660          161 WVAVLPTGSRNPTKPF  176 (487)
Q Consensus       161 ~~~Ll~~g~~~~~~~~  176 (487)
                      ..+|+.+|++....+.
T Consensus       188 a~lLV~~gAd~~~edk  203 (226)
T KOG4412|consen  188 AVLLVRAGADTDREDK  203 (226)
T ss_pred             HHHHHHhccceeeccc
Confidence            9999999999877763



>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3842 consensus Adaptor protein Pellino [Signal transduction mechanisms] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query487
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-15
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-13
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-12
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 8e-12
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-11
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-08
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-08
2xeh_A157 Structural Determinants For Improved Thermal Stabil 4e-08
2xee_A157 Structural Determinants For Improved Thermal Stabil 4e-08
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 7e-08
3so8_A162 Crystal Structure Of Ankra Length = 162 8e-08
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 8e-08
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 9e-08
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 1e-07
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 1e-07
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-07
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-07
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 2e-07
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 2e-07
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-07
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-07
3uxg_A172 Crystal Structure Of Rfxank Length = 172 4e-07
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 9e-07
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-06
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-06
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-06
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-06
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 3e-06
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 5e-06
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 5e-06
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 7e-06
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 7e-06
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 7e-06
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 8e-06
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 9e-06
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-05
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-05
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 1e-05
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 2e-05
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 3e-05
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-05
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 7e-05
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 9e-05
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-04
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 1e-04
1uoh_A226 Human Gankyrin Length = 226 1e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-04
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 2e-04
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 8e-04
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-04
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 2e-04
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 3e-04
3eb5_A74 Structure Of The Ciap2 Ring Domain Length = 74 3e-04
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-04
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 4e-04
3t6p_A345 Iap Antagonist-Induced Conformational Change In Cia 5e-04
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 5e-04
4ayc_B138 Rnf8 Ring Domain Structure Length = 138 5e-04
4ayc_A138 Rnf8 Ring Domain Structure Length = 138 6e-04
4epo_C149 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 9e-04
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure

Iteration: 1

Score = 79.3 bits (194), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 52/129 (40%), Positives = 70/129 (54%), Gaps = 7/129 (5%) Query: 11 LYQQVNYGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTLIELGAKVDAY 70 L+ G+ E +K L GA + D +G+TPL A N G +V K LI GA V+A Sbjct: 41 LHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAEN-GHKEVVKLLISKGADVNAK 99 Query: 71 RPGRHGGTPLHHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKGFTNVVRAIEN 130 G TPLHHAA+ G + VKLL+S GA+ + D +TPL++AR G VV+ +E Sbjct: 100 DSD--GRTPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAREHGNEEVVKLLEK 157 Query: 131 HICIFSGWL 139 GWL Sbjct: 158 Q----GGWL 162
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|4AYC|B Chain B, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure
>pdb|4AYC|A Chain A, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure
>pdb|4EPO|C Chain C, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query487
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-26
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-17
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-24
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-20
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-19
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-23
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-21
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-09
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-23
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-22
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-22
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-19
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-19
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-08
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-23
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-22
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-22
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-20
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-18
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-13
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-22
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-22
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-18
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-18
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-13
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-22
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-18
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-14
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-22
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-18
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-16
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-22
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-18
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 9e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-22
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-21
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-20
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-17
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-13
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-22
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-17
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-14
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-22
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-17
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-13
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-22
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-19
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-16
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 8e-10
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-22
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-04
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-21
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-21
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-21
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-17
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-16
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-21
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-18
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-17
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-21
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-19
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-19
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-18
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-16
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-21
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-15
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-20
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-19
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-17
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-20
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-20
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-18
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-18
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-20
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-20
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-18
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-16
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-12
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-20
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-17
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-15
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-20
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-20
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-15
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-13
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-20
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-18
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-18
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-16
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-20
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-18
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-15
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-13
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-20
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-19
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-20
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-18
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-19
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-17
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-14
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-19
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-17
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-16
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-15
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-19
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-14
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-19
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-17
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-16
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-19
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-17
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-16
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-16
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-19
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-16
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-15
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-19
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-19
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-17
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-17
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-16
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-18
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-15
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-12
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-10
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-18
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-18
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-18
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-17
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-17
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-16
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-18
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-18
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-18
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-17
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-17
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-16
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 1e-17
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-17
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-16
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-14
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-17
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-16
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-16
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-06
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 5e-17
2rfa_A232 Transient receptor potential cation channel subfa 7e-16
2rfa_A232 Transient receptor potential cation channel subfa 5e-14
2rfa_A232 Transient receptor potential cation channel subfa 2e-13
2rfa_A232 Transient receptor potential cation channel subfa 8e-13
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 2e-15
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 3e-15
2etb_A256 Transient receptor potential cation channel subfam 8e-15
2etb_A256 Transient receptor potential cation channel subfam 7e-14
2etb_A256 Transient receptor potential cation channel subfam 4e-12
2etb_A256 Transient receptor potential cation channel subfam 1e-11
2etb_A256 Transient receptor potential cation channel subfam 8e-06
2pnn_A273 Transient receptor potential cation channel subfa 2e-14
2pnn_A273 Transient receptor potential cation channel subfa 3e-13
2pnn_A273 Transient receptor potential cation channel subfa 2e-10
2pnn_A273 Transient receptor potential cation channel subfa 1e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-14
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-11
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-04
2ea5_A68 Cell growth regulator with ring finger domain prot 5e-14
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 1e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 8e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 7e-05
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 8e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 9e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-08
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 6e-08
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 7e-08
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 2e-07
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 3e-07
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 4e-07
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 6e-07
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 1e-06
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 3e-06
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 3e-06
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 4e-06
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 5e-06
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 6e-06
1z6u_A150 NP95-like ring finger protein isoform B; structura 8e-06
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 9e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 1e-04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 3e-04
2ysl_A73 Tripartite motif-containing protein 31; ring-type 3e-04
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 5e-04
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 5e-04
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 6e-04
2ecw_A85 Tripartite motif-containing protein 30; metal bind 6e-04
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 8e-04
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 8e-04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 8e-04
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
 Score =  101 bits (254), Expect = 8e-26
 Identities = 35/115 (30%), Positives = 57/115 (49%), Gaps = 3/115 (2%)

Query: 17  YGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTLIELGAKVDAYRPGRHG 76
            G++  ++ L ++G+     D  G TPL  AC + G   V + L++  A V+    G   
Sbjct: 20  KGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNH-GHLKVVELLLQHKALVNT--TGYQN 76

Query: 77  GTPLHHAAKRGLERTVKLLLSYGANALVLNDDCQTPLEVARAKGFTNVVRAIENH 131
            +PLH AAK G    VKLLLSYGA+   +N     P++    +   +++   E +
Sbjct: 77  DSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMKSLLLLPEKN 131


>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query487
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.98
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.98
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.98
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.98
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.98
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.98
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.97
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.97
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.97
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.97
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.97
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.97
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.97
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.97
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.97
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.97
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.97
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.96
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.96
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.96
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.96
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.96
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.96
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.96
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.96
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.96
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.95
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.95
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.95
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.94
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.94
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.94
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.93
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.92
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.92
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.92
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.9
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.9
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.9
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.9
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.9
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.88
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.88
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.87
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.86
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.86
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.85
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.84
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.84
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.84
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.84
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.79
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.78
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.48
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.47
2ea5_A68 Cell growth regulator with ring finger domain prot 99.42
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.25
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.2
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.19
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.16
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.16
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.16
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.13
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.12
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.12
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.1
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.09
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.08
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.07
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.05
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.05
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.05
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.04
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.03
2ect_A78 Ring finger protein 126; metal binding protein, st 99.03
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.01
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.0
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.99
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.98
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.98
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.97
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.97
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.96
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.95
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.95
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.94
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.91
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.9
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.89
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.87
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.86
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.86
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.84
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.84
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.81
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.81
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.8
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.79
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.79
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.77
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.77
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.74
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.74
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.73
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.69
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.69
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.68
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.68
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.64
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.56
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.51
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.46
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.43
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.43
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.42
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.27
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.16
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.12
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.11
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.95
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.69
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.66
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.37
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.21
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 96.53
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 93.62
3nw0_A238 Non-structural maintenance of chromosomes element 92.43
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 91.59
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=100.00  E-value=2.6e-35  Score=262.09  Aligned_cols=159  Identities=33%  Similarity=0.426  Sum_probs=150.5

Q ss_pred             HHHHHHHHcCCHHHHHHHHHcCCCCCccCCCCChHHHHHHhCCCcHHHHHHHHHcCCCccccCCCCCCCcHHHHHHHhCC
Q 040660            9 ELLYQQVNYGNVEGIKALCRDGAGLEWIDKEGKTPLIAACMNPGLYDVAKTLIELGAKVDAYRPGRHGGTPLHHAAKRGL   88 (487)
Q Consensus         9 t~L~~Aa~~g~~~~v~~Ll~~g~~~~~~d~~G~TpL~~A~~~~g~~~~v~~Ll~~ga~~~~~~~d~~g~TpLh~Aa~~g~   88 (487)
                      +.|+.||+.|+.++|+.||++|+++|.+|..|+||||+|+.. ++.+++++|++.|++++.+  |..|+||||+|+..|+
T Consensus         6 ~~L~~Aa~~G~~~~v~~Ll~~Gadvn~~d~~g~t~l~~a~~~-~~~~~~~~ll~~gad~~~~--d~~g~TpLh~A~~~g~   82 (169)
T 4gpm_A            6 KRLIEAAENGNKDRVKDLIENGADVNASDSDGRTPLHHAAEN-GHKEVVKLLISKGADVNAK--DSDGRTPLHHAAENGH   82 (169)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHT-TCHHHHHHHHHTTCCTTCC--CTTSCCHHHHHHHTTC
T ss_pred             HHHHHHHHcCCHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHc-CCHHHHHHHHhcccchhhh--ccCCCCHHHHHHHcCC
Confidence            579999999999999999999999999999999999999999 9999999999999999998  9999999999999999


Q ss_pred             HHHHHHHHHcCCCcccccCCCCCHHHHHHHcCCHHHHHHHHhCCCcccccccccCCCCHHHHHhhhcCCHHHHHHhhcCC
Q 040660           89 ERTVKLLLSYGANALVLNDDCQTPLEVARAKGFTNVVRAIENHICIFSGWLRELYGPGFLELLAPQLLSRKVWVAVLPTG  168 (487)
Q Consensus        89 ~~~v~~Ll~~ga~~~~~d~~g~TpL~~A~~~g~~~~v~~Ll~~ga~~~~~~~d~~G~t~L~~~a~~~~~~~~~~~Ll~~g  168 (487)
                      .++|++|+++|++++.+|.+|+||||+|+..|+.++|++|+++|++++  .+|..|.|||| +|...++.+++++|+++|
T Consensus        83 ~~~v~~Ll~~gadvn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~gad~~--~~d~~G~TpL~-~A~~~g~~~iv~~Ll~~G  159 (169)
T 4gpm_A           83 KEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVN--TSDSDGRTPLD-LAREHGNEEVVKLLEKQG  159 (169)
T ss_dssp             HHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTT--CCCTTSCCHHH-HHHHTTCHHHHHHHHTC-
T ss_pred             HHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCcc--ccCCCCCCHHH-HHHHcCCHHHHHHHHHCC
Confidence            999999999999999999999999999999999999999999999999  99999999999 999999999999999999


Q ss_pred             CCCCC
Q 040660          169 SRNPT  173 (487)
Q Consensus       169 ~~~~~  173 (487)
                      ++++.
T Consensus       160 A~ie~  164 (169)
T 4gpm_A          160 GWLEH  164 (169)
T ss_dssp             -----
T ss_pred             CCcCC
Confidence            99754



>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 487
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-13
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-09
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-13
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-12
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-12
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-12
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.004
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-11
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-09
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 8e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-05
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 4e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 7e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.003
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 1e-08
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 8e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-07
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 4e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 8e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.003
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-04
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 4e-06
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 8e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 9e-05
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 9e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-04
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.002
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 0.001
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 76.6 bits (187), Expect = 1e-15
 Identities = 31/104 (29%), Positives = 42/104 (40%), Gaps = 3/104 (2%)

Query: 42  TPLIAACMNPGLYDVAKTLIELGAKVDAYRPGRHGGTPLHHAAKRGLERTVKLLLSYGAN 101
           TPL  A    G   + K L++ GA  +         TPLH AA+ G     K LL   A 
Sbjct: 2   TPLHVASFM-GHLPIVKNLLQRGASPNV--SNVKVETPLHMAARAGHTEVAKYLLQNKAK 58

Query: 102 ALVLNDDCQTPLEVARAKGFTNVVRAIENHICIFSGWLRELYGP 145
                 D QTPL  A   G TN+V+ +  +    +      + P
Sbjct: 59  VNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTP 102


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query487
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.97
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.96
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.96
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.95
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.95
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.95
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.94
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.94
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.94
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.93
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.93
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.93
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.92
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.92
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.91
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.91
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.9
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.9
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.9
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.88
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.87
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.86
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.85
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.83
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.83
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.17
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.06
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.03
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.0
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.98
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.92
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.88
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.86
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.81
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.79
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.61
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.6
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.59
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.55
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.32
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.41
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 92.07
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.97  E-value=2.8e-31  Score=249.45  Aligned_cols=193  Identities=22%  Similarity=0.178  Sum_probs=171.7

Q ss_pred             CCCCchHHHHHHHHcCCHHHHHHHHHcCCC---CCccCCCCChHHHHHHhCCCcHHHHHHHHHcCCCccccCCCCCCCcH
Q 040660            3 LQQSKEELLYQQVNYGNVEGIKALCRDGAG---LEWIDKEGKTPLIAACMNPGLYDVAKTLIELGAKVDAYRPGRHGGTP   79 (487)
Q Consensus         3 ~d~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~---~~~~d~~G~TpL~~A~~~~g~~~~v~~Ll~~ga~~~~~~~d~~g~Tp   79 (487)
                      ++++|+||||+||+.|+.++|++||++|++   ++.+|..|+||||+|+.. |+.+++++|+++|++++.+  |.+|.||
T Consensus         5 i~~~G~t~Lh~A~~~~~~~~v~~Ll~~~a~~~~i~~~~~~g~TpL~~A~~~-g~~~iv~~Ll~~ga~i~~~--d~~g~tp   81 (255)
T d1oy3d_           5 VTEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAIL-GEASTVEKLYAAGAGVLVA--ERGGHTA   81 (255)
T ss_dssp             CCTTCCCHHHHHHHTTCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHH-TCHHHHHHHHHTTCCSSCC--CTTSCCH
T ss_pred             CCcCCCCHHHHHHHcCCHHHHHHHHHcCCCcccccCcCCCCCCccchHHhh-ccccccccccccccccccc--ccccchh
Confidence            689999999999999999999999999988   667788999999999999 9999999999999999998  8999999


Q ss_pred             HHHHHHhCCHHHHHHHHHc-----------------------------------------------CCCcccccCCCCCH
Q 040660           80 LHHAAKRGLERTVKLLLSY-----------------------------------------------GANALVLNDDCQTP  112 (487)
Q Consensus        80 Lh~Aa~~g~~~~v~~Ll~~-----------------------------------------------ga~~~~~d~~g~Tp  112 (487)
                      ||+|+..|+.+++++|++.                                               +.+++.+|.+|+||
T Consensus        82 L~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~~g~Tp  161 (255)
T d1oy3d_          82 LHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTP  161 (255)
T ss_dssp             HHHHTTTTCHHHHHHHSSSCCSSCCCC-----------------------------------CCCGGGGTTCCCTTSCCH
T ss_pred             hhhhhccCchHHHHHHHhhccchhcccchhhhhHHhhhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccccCccc
Confidence            9999999999999998753                                               23455678889999


Q ss_pred             HHHHHHcCCHHHHHHHHhCCCcccccccccCCCCHHHHHhhhcCCHHHHHHhhcCCCCCCCCCCccchhccccccccchH
Q 040660          113 LEVARAKGFTNVVRAIENHICIFSGWLRELYGPGFLELLAPQLLSRKVWVAVLPTGSRNPTKPFKLELAIYPSLLDARPR  192 (487)
Q Consensus       113 L~~A~~~g~~~~v~~Ll~~ga~~~~~~~d~~G~t~L~~~a~~~~~~~~~~~Ll~~g~~~~~~~~~~~~~~~~~~~~~~~~  192 (487)
                      ||+|+.+++.++|++|++++++.+ ..++..|.|||| +|+..++.+++++|+++|++++.++..+..+++.+...+...
T Consensus       162 Lh~A~~~~~~~~v~~Ll~~~~~~~-~~~~~~g~TpL~-~A~~~~~~~~v~~Ll~~gadin~~d~~g~t~L~~A~~~~~~~  239 (255)
T d1oy3d_         162 LHVAVIHKDAEMVRLLRDAGADLN-KPEPTCGRTPLH-LAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPI  239 (255)
T ss_dssp             HHHHHHTTCHHHHHHHHHHTCCTT-CCCTTTCCCHHH-HHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHTSSCHH
T ss_pred             ccccccccccccccchhccccccc-cccccccccccc-ccccccHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHH
Confidence            999999999999999999998877 135678999999 888999999999999999999999888888888888888888


Q ss_pred             HHHHHHhc
Q 040660          193 MVIALWKA  200 (487)
Q Consensus       193 ~~~~l~~~  200 (487)
                      .+..|...
T Consensus       240 i~~~Ll~~  247 (255)
T d1oy3d_         240 LARLLRAH  247 (255)
T ss_dssp             HHHHHHHT
T ss_pred             HHHHHHHc
Confidence            88776643



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure