Citrus Sinensis ID: 040710

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
YHSTQILLVLEMGWRLFLHLIACPRQLSVLAHFSESWINILKISDRKRLVSISSIRPLLYVANSLRVINYMLEIVGTDMHQLAVELDTFKNDFDVDGNHVAIDTTSISQPVAVESLNSTGVDLKSGKNITVIIQYNGSQNLIYVNVRDTDHPPKNVIKQPINLSDIVPSSVYVGFTAATGALAESHQLLEWSLTSQPLPLSE
cccccEEEEEEEEEEEEccccccccccccEEEEEEEEEEEEEccccccEEEEccccccccccccEEEEccccccccccccEEEEEEccccccccccccEEEEEEcccccccEEcccccccEEEccccEEEEEEEEEccccEEEEEEEEccccccEEEEEEEcccccccccEEEEEEcccccccccEEEEEEEEEcccccccc
ccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEEEccccEEEEEEccccccccccHHcEEEEEccccccccEEEEEEEEccccccccccccEEEEEcccEEEEcccccccccEEEcccccEEEEEEEcccEEEEEEEEcccccccccEEEEEEcccHHccccEEEEEEccccccccEEEEEEEEEccccccccc
YHSTQILLVLEMGWRLFLHLIACPRQLSVLAHFSESWINILkisdrkrlvsissirpllyVANSLRVINYMLEIVGTDMHQLAVELDtfkndfdvdgnhvaidttsisqpVAVESlnstgvdlksgkNITVIIQYNGSQNLIYVnvrdtdhppknvikqpinlsdivpssvyvGFTAATGALAESHQLLEWsltsqplplse
YHSTQILLVLEMGWRLFLHLIACPRQLSVLAHFSESWINIlkisdrkrlvsissirpllyvANSLRVINYMLEIVGTDMHQLAVELDTFKNDFDVDGNHVAIdttsisqpvAVESLNstgvdlksgKNITVIIQYNGSQNLIYVNVRDTDHPPKNVIkqpinlsdivPSSVYVGFTAATGALAESHQLLewsltsqplplse
YHSTQILLVLEMGWRLFLHLIACPRQLSVLAHFSESWINILKISDRKRLVSISSIRPLLYVANSLRVINYMLEIVGTDMHQLAVELDTFKNDFDVDGNHVAIDTTSISQPVAVESLNSTGVDLKSGKNITVIIQYNGSQNLIYVNVRDTDHPPKNVIKQPINLSDIVPSSVYVGFTAATGALAESHQLLEWSLTSQPLPLSE
****QILLVLEMGWRLFLHLIACPRQLSVLAHFSESWINILKISDRKRLVSISSIRPLLYVANSLRVINYMLEIVGTDMHQLAVELDTFKNDFDVDGNHVAIDTTSISQPVAVESLNSTGVDLKSGKNITVIIQYNGSQNLIYVNVRDTDHPPKNVIKQPINLSDIVPSSVYVGFTAATGALAESHQLLEWS**********
***TQILLVLEMGWRLFLHLIACPRQLSVLAHFSESWINILKISDRKRLVSISSIRPLLYVANSLRVINYMLEIVGTDMHQLAVELDTFKNDFDVDGNHVAIDTTSISQPVAVESLNSTGVDLKSGKNITVIIQYNGSQNLIYVNVRDTDHPPKNVIKQPINLSDIVPSSVYVGFTAATGALAESHQLLEWSLT*QPL****
YHSTQILLVLEMGWRLFLHLIACPRQLSVLAHFSESWINILKISDRKRLVSISSIRPLLYVANSLRVINYMLEIVGTDMHQLAVELDTFKNDFDVDGNHVAIDTTSISQPVAVESLNSTGVDLKSGKNITVIIQYNGSQNLIYVNVRDTDHPPKNVIKQPINLSDIVPSSVYVGFTAATGALAESHQLLEWSL*********
YHSTQILLVLEMGWRLFLHLIACPRQLSVLAHFSESWINILKISDRKRLVSISSIRPLLYVANSLRVINYMLEIVGTDMHQLAVELDTFKNDFDVDGNHVAIDTTSISQPVAVESLNSTGVDLKSGKNITVIIQYNGSQNLIYVNVRDTDHPPKNVIKQPINLSDIVPSSVYVGFTAATGALAESHQLLEWSLTSQ******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHSTQILLVLEMGWRLFLHLIACPRQLSVLAHFSESWINILKISDRKRLVSISSIRPLLYVANSLRVINYMLEIVGTDMHQLAVELDTFKNDFDVDGNHVAIDTTSISQPVAVESLNSTGVDLKSGKNITVIIQYNGSQNLIYVNVRDTDHPPKNVIKQPINLSDIVPSSVYVGFTAATGALAESHQLLEWSLTSQPLPLSE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query202 2.2.26 [Sep-21-2011]
Q9ZW11 623 Putative inactive L-type no no 0.544 0.176 0.370 1e-11
Q9LSR8 766 L-type lectin-domain cont no no 0.584 0.154 0.379 2e-11
Q9LSR9 657 L-type lectin-domain cont no no 0.564 0.173 0.344 3e-11
Q9FG33 652 Probable L-type lectin-do no no 0.544 0.168 0.382 4e-11
Q9S9U1 686 L-type lectin-domain cont no no 0.534 0.157 0.344 1e-10
Q9M3D8 664 L-type lectin-domain cont no no 0.564 0.171 0.356 1e-10
Q9FIF1 674 Probable L-type lectin-do no no 0.564 0.169 0.338 2e-10
O49445 681 Probable L-type lectin-do no no 0.529 0.157 0.344 2e-10
Q9M2S4 684 L-type lectin-domain cont no no 0.564 0.166 0.349 2e-10
Q9SR87 693 Probable L-type lectin-do no no 0.574 0.167 0.346 2e-10
>sp|Q9ZW11|LRK32_ARATH Putative inactive L-type lectin-domain containing receptor kinase III.2 OS=Arabidopsis thaliana GN=LECRK32 PE=3 SV=1 Back     alignment and function desciption
 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 70/127 (55%), Gaps = 17/127 (13%)

Query: 82  LAVELDTFK--NDFDVDGNHVAIDTTSISQPVAVESLNSTGVD----------LKSGKNI 129
           LAVE DT +     D+D NHV ID   +   +++ES ++   D          L SGK I
Sbjct: 139 LAVEFDTVQAVELNDIDDNHVGIDLNGV---ISIESTSAEYFDDREAKNISLRLASGKPI 195

Query: 130 TVIIQYNGSQNLIYVNVRDTDHP-PK-NVIKQPINLSDIVPSSVYVGFTAATGALAESHQ 187
            V I+YN ++ ++ V +   D P PK  ++ + +NLS I+    YVGF+AATG +  SH 
Sbjct: 196 RVWIEYNATETMLNVTLAPLDRPKPKLPLLSRKLNLSGIISEENYVGFSAATGTVTSSHF 255

Query: 188 LLEWSLT 194
           +L WS +
Sbjct: 256 VLGWSFS 262

Arabidopsis thaliana (taxid: 3702)
>sp|Q9LSR8|LRK19_ARATH L-type lectin-domain containing receptor kinase I.9 OS=Arabidopsis thaliana GN=LECRK19 PE=1 SV=2 Back     alignment and function description
>sp|Q9LSR9|LRK18_ARATH L-type lectin-domain containing receptor kinase I.8 OS=Arabidopsis thaliana GN=LECRK18 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG33|LRKS5_ARATH Probable L-type lectin-domain containing receptor kinase S.5 OS=Arabidopsis thaliana GN=LECRKS5 PE=2 SV=1 Back     alignment and function description
>sp|Q9S9U1|LRK71_ARATH L-type lectin-domain containing receptor kinase VII.1 OS=Arabidopsis thaliana GN=LECRK71 PE=2 SV=1 Back     alignment and function description
>sp|Q9M3D8|LRK13_ARATH L-type lectin-domain containing receptor kinase I.3 OS=Arabidopsis thaliana GN=LECRK13 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIF1|LRK21_ARATH Probable L-type lectin-domain containing receptor kinase II.1 OS=Arabidopsis thaliana GN=LECRK21 PE=2 SV=1 Back     alignment and function description
>sp|O49445|LRK72_ARATH Probable L-type lectin-domain containing receptor kinase VII.2 OS=Arabidopsis thaliana GN=LECRK72 PE=1 SV=2 Back     alignment and function description
>sp|Q9M2S4|LRKS4_ARATH L-type lectin-domain containing receptor kinase S.4 OS=Arabidopsis thaliana GN=LECRKS4 PE=1 SV=1 Back     alignment and function description
>sp|Q9SR87|LRK61_ARATH Probable L-type lectin-domain containing receptor kinase VI.1 OS=Arabidopsis thaliana GN=LECRK61 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
296082025 569 unnamed protein product [Vitis vinifera] 0.787 0.279 0.418 7e-33
359476128 661 PREDICTED: probable L-type lectin-domain 0.623 0.190 0.507 1e-29
255548946 584 conserved hypothetical protein [Ricinus 0.594 0.205 0.491 2e-24
11596188268 lectin-related protein precursor [Citrus 0.599 0.451 0.469 7e-17
242082227 753 hypothetical protein SORBIDRAFT_07g02741 0.569 0.152 0.362 2e-13
218201446 716 hypothetical protein OsI_29867 [Oryza sa 0.668 0.188 0.352 3e-13
125603999 682 hypothetical protein OsJ_27920 [Oryza sa 0.668 0.197 0.352 3e-13
115477264 739 Os08g0514000 [Oryza sativa Japonica Grou 0.668 0.182 0.352 4e-13
225434861 675 PREDICTED: L-type lectin-domain containi 0.603 0.180 0.424 8e-13
326492598 694 predicted protein [Hordeum vulgare subsp 0.574 0.167 0.344 4e-12
>gi|296082025|emb|CBI21030.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  145 bits (367), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 82/196 (41%), Positives = 109/196 (55%), Gaps = 37/196 (18%)

Query: 6   ILLVLEMGWRLFLHLIACPRQLSVLAHFSESWINILKISDRKRLVSISSIRPLLYVANSL 65
           I L L M W L  H IA P QL  LA F ESW                            
Sbjct: 114 IQLGLAMEWPLSWHRIANPPQLVALARFLESW---------------------------- 145

Query: 66  RVINYMLEIVGTDMHQLAVELDTFKNDFDVDGNHVAIDTTSISQPVAVESLNSTGVDLKS 125
                     G  + QLAVELDT+ N+FD D NH+ IDTTSI+ P+A +SL+ TGVDLKS
Sbjct: 146 ---------TGGVVRQLAVELDTYMNEFDPDANHIGIDTTSIAIPIAAKSLSGTGVDLKS 196

Query: 126 GKNITVIIQYNGSQNLIYVNVRDTDHPPKNVIKQPINLSDIVPSSVYVGFTAATGALAES 185
           G+ + V I Y+G +  ++++V    +P  + +   I LSD VPSSVYVGFT +TG ++E+
Sbjct: 197 GREVKVKIDYDGWRETLHISVGYAGNPLLSFLNHSIALSDTVPSSVYVGFTGSTGTVSET 256

Query: 186 HQLLEWSLTSQPLPLS 201
           HQ+L+W+ TS P+  S
Sbjct: 257 HQVLDWAFTSIPITCS 272

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359476128|ref|XP_002282629.2| PREDICTED: probable L-type lectin-domain containing receptor kinase S.7-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255548946|ref|XP_002515529.1| conserved hypothetical protein [Ricinus communis] gi|223545473|gb|EEF46978.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|11596188|gb|AAG38522.1|AF283537_1 lectin-related protein precursor [Citrus x paradisi] Back     alignment and taxonomy information
>gi|242082227|ref|XP_002445882.1| hypothetical protein SORBIDRAFT_07g027410 [Sorghum bicolor] gi|241942232|gb|EES15377.1| hypothetical protein SORBIDRAFT_07g027410 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|218201446|gb|EEC83873.1| hypothetical protein OsI_29867 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|125603999|gb|EAZ43324.1| hypothetical protein OsJ_27920 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|115477264|ref|NP_001062228.1| Os08g0514000 [Oryza sativa Japonica Group] gi|42408815|dbj|BAD10076.1| putative lectin-like protein kinase [Oryza sativa Japonica Group] gi|113624197|dbj|BAF24142.1| Os08g0514000 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|225434861|ref|XP_002280641.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|326492598|dbj|BAJ90155.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
TAIR|locus:2025037258 AT1G07460 [Arabidopsis thalian 0.584 0.457 0.395 2.6e-15
TAIR|locus:2097613 693 AT3G08870 [Arabidopsis thalian 0.574 0.167 0.346 3.5e-14
TAIR|locus:2170224 652 AT5G06740 [Arabidopsis thalian 0.539 0.167 0.377 1.7e-13
TAIR|locus:2138381 686 AT4G04960 [Arabidopsis thalian 0.603 0.177 0.358 5e-13
TAIR|locus:2144045 766 LecRK-I.9 "lectin receptor kin 0.569 0.150 0.388 5.9e-13
TAIR|locus:2144025 657 AT5G60280 [Arabidopsis thalian 0.564 0.173 0.352 7.7e-13
TAIR|locus:2143528 711 AT5G03140 [Arabidopsis thalian 0.613 0.174 0.343 1.1e-12
TAIR|locus:2043127 623 AT2G29250 [Arabidopsis thalian 0.544 0.176 0.370 1.9e-12
TAIR|locus:2144055 616 AT5G60310 [Arabidopsis thalian 0.564 0.185 0.387 5e-12
TAIR|locus:2099941 684 AT3G55550 [Arabidopsis thalian 0.584 0.172 0.346 9.7e-12
TAIR|locus:2025037 AT1G07460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 193 (73.0 bits), Expect = 2.6e-15, P = 2.6e-15
 Identities = 51/129 (39%), Positives = 73/129 (56%)

Query:    82 LAVELDTFK-NDF-DVDGNHVAIDTTSI----SQPVAVES-LNSTGVDLK-SGKN-ITVI 132
             LAVE DT K N+F D+D NHV ID   +    S P A  S   S  + LK S K+ I   
Sbjct:    74 LAVEFDTVKSNEFLDIDDNHVGIDVNGLVSVESAPAAFFSNKQSKNISLKLSSKDPIRAW 133

Query:   133 IQYNGSQNLIYVNVR--DTDHPPKNVIKQPINLSDIVPSSVYVGFTAATGALAESHQLLE 190
             I+YNG + L+ V +   DT  P   ++ + +NLS+I    +YVGF+A+TG +  +H +L 
Sbjct:   134 IEYNGVERLLNVTLATLDTSKPNFPLLSRQMNLSEIFMEKMYVGFSASTGNITSNHDVLG 193

Query:   191 WSLTSQPLP 199
             WS + +  P
Sbjct:   194 WSFSREGKP 202
GO:0005886 "plasma membrane" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0030246 "carbohydrate binding" evidence=ISS
GO:0031225 "anchored to membrane" evidence=TAS
TAIR|locus:2097613 AT3G08870 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170224 AT5G06740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138381 AT4G04960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144045 LecRK-I.9 "lectin receptor kinase I.9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144025 AT5G60280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143528 AT5G03140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043127 AT2G29250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144055 AT5G60310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099941 AT3G55550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00032635001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (599 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
pfam00139231 pfam00139, Lectin_legB, Legume lectin domain 2e-33
cd06899236 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume 1e-32
cd01951223 cd01951, lectin_L-type, legume lectins 2e-23
cd07308218 cd07308, lectin_leg-like, legume-like lectins: ERG 0.001
>gnl|CDD|215744 pfam00139, Lectin_legB, Legume lectin domain Back     alignment and domain information 
 Score =  119 bits (300), Expect = 2e-33
 Identities = 51/117 (43%), Positives = 70/117 (59%), Gaps = 3/117 (2%)

Query: 80  HQLAVELDTFKNDF--DVDGNHVAIDTTSISQPVAVESLNSTGVDLKSGKNITVIIQYNG 137
           H +AVE DTF N    D+D NHV ID  SI   VA ES +   +DL SGK I V I Y+G
Sbjct: 116 HIVAVEFDTFLNPEFNDIDDNHVGIDVNSII-SVASESASFVPLDLNSGKPIQVWIDYDG 174

Query: 138 SQNLIYVNVRDTDHPPKNVIKQPINLSDIVPSSVYVGFTAATGALAESHQLLEWSLT 194
           S   + V +   + P + ++   ++LS ++P  VYVGF+A+TG   ESH +L WS +
Sbjct: 175 SSKRLSVTLAYPNKPKRPLLSASVDLSTVLPEWVYVGFSASTGGATESHYVLSWSFS 231

Length = 231
>gnl|CDD|173887 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information
>gnl|CDD|173886 cd01951, lectin_L-type, legume lectins Back     alignment and domain information
>gnl|CDD|173892 cd07308, lectin_leg-like, legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 202
cd06899236 lectin_legume_LecRK_Arcelin_ConA legume lectins, l 100.0
PF00139236 Lectin_legB: Legume lectin domain; InterPro: IPR00 100.0
cd01951223 lectin_L-type legume lectins. The L-type (legume-t 100.0
cd07308218 lectin_leg-like legume-like lectins: ERGIC-53, ERG 99.62
cd06902225 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran 99.09
cd06901248 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr 98.98
cd06903215 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem 98.28
PF03388229 Lectin_leg-like: Legume-like lectin family; InterP 98.09
KOG3838 497 consensus Mannose lectin ERGIC-53, involved in gly 95.99
cd06900255 lectin_VcfQ VcfQ bacterial pilus biogenesis protei 95.96
KOG3839351 consensus Lectin VIP36, involved in the transport 95.87
>cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information 
Probab=100.00  E-value=9.6e-46  Score=314.60  Aligned_cols=191  Identities=32%  Similarity=0.481  Sum_probs=161.2

Q ss_pred             ceEEEEEEe--ceEEeeeeecCeEeccc-----cceeeEEe-eeeeeeCC---ccee-eeecc--CCCCCCCCCeeeeec
Q 040710            4 TQILLVLEM--GWRLFLHLIACPRQLSV-----LAHFSESW-INILKISD---RKRL-VSISS--IRPLLYVANSLRVIN   69 (202)
Q Consensus         4 ~~~~~~~~~--g~~~~~~~y~~p~~l~~-----~asFsT~F-F~i~~~~~---~~~~-~~~~~--~~P~~~~gg~LGL~~   69 (202)
                      ..|-|+...  ..++++++|++|++||+     ++||+|+| |.|.+...   ..++ |.+..  ..|.+..|++|||.+
T Consensus        27 ~~i~LT~~~~~~~~~G~v~y~~pi~l~~~~~~~~~sFst~F~F~i~~~~~~~~gdGlAF~i~~~~~~~~~~~G~~lG~~~  106 (236)
T cd06899          27 GALQLTNDTSPASSVGRALYSKPVRLWDSTTGKVASFSTSFSFSITPPNPSLGGDGLAFFLAPTDSLPPASSGGYLGLFN  106 (236)
T ss_pred             CeEEecCCCCCCcceEEEEeCCCEEeecCCCCCceeEEEEEEEEEEcCCCCCCCCeEEEEEecCCCCCCCCCcceeeeec
Confidence            456777776  77899999999999997     79999999 99975431   2233 33222  233356789999998


Q ss_pred             cccccCCCCCcEEEEEEeCCCC-CC-CCCCCeEEEecCCCcCceeeeecCCCccccCCCceEEEEEEEcCCccEEEEEEe
Q 040710           70 YMLEIVGTDMHQLAVELDTFKN-DF-DVDGNHVAIDTTSISQPVAVESLNSTGVDLKSGKNITVIIQYNGSQNLIYVNVR  147 (202)
Q Consensus        70 ~~~~~~~~~n~~vAVEFDT~~n-~~-Dp~~nHVgIdvns~~~S~~~~~~~~~~~~l~~G~~~~vwI~Yd~~~~~L~V~l~  147 (202)
                      ....+ .+.++.|||||||++| ++ ||++||||||+|++. |..+..+......|.+|+.++|||+||+.+++|+|+|.
T Consensus       107 ~~~~~-~~~~~~vAVEFDT~~n~~~~D~~~nHigIdvn~~~-S~~~~~~~~~~~~l~~g~~~~v~I~Y~~~~~~L~V~l~  184 (236)
T cd06899         107 SSNNG-NSSNHIVAVEFDTFQNPEFGDPDDNHVGIDVNSLV-SVKAGYWDDDGGKLKSGKPMQAWIDYDSSSKRLSVTLA  184 (236)
T ss_pred             CCCCC-CcccceEEEEeecccCcccCCCCCCeEEEEcCCcc-cceeeccccccccccCCCeEEEEEEEcCCCCEEEEEEE
Confidence            76554 2678999999999999 67 999999999999998 88887776445668999999999999999999999999


Q ss_pred             eC--CCCCceeeeeeeccCCCCCCeEEEEEeeecCCCccceEEEEEEEeec
Q 040710          148 DT--DHPPKNVIKQPINLSDIVPSSVYVGFTAATGALAESHQLLEWSLTSQ  196 (202)
Q Consensus       148 ~~--~kp~~plLs~~vdLs~~l~~~v~VGFSAsTG~~~~~h~I~sWsF~s~  196 (202)
                      ..  .||..|+|++++||+.+|+++|||||||+||...|.|+|++|+|++.
T Consensus       185 ~~~~~~~~~~~ls~~vdL~~~l~~~~~vGFSasTG~~~~~h~i~sWsF~s~  235 (236)
T cd06899         185 YSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWSFSSN  235 (236)
T ss_pred             eCCCCCCcCCEEEEeccHHHhCCCceEEEEEeEcCCCcceEEEEEEEEEcC
Confidence            85  37899999999999999999999999999999999999999999985

This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin
>PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported Back     alignment and domain information
>cd01951 lectin_L-type legume lectins Back     alignment and domain information
>cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 Back     alignment and domain information
>cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain Back     alignment and domain information
>cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates Back     alignment and domain information
>KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain Back     alignment and domain information
>KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
3ujo_A281 Galactose-Specific Seed Lectin From Dolichos Lablab 4e-11
2sba_A253 Soybean Agglutinin Complexed With 2,6-Pentasacchari 9e-11
1lul_A253 Db58, A Legume Lectin From Dolichos Biflorus Length 2e-10
1g8w_A233 Improved Structure Of Phytohemagglutinin-L From The 3e-10
1fat_A252 Phytohemagglutinin-L Length = 252 3e-10
2bqp_A234 The Structure Of The Pea Lectin-D-Glucopyranose Com 9e-10
1n47_A233 Isolectin B4 From Vicia Villosa In Complex With The 1e-09
1bjq_A253 The Dolichos Biflorus Seed Lectin In Complex With A 4e-09
3ipv_A251 Crystal Structure Of Spatholobus Parviflorus Seed L 6e-09
3zvx_A261 Structure Of The Lectin From Platypodium Elegans In 6e-09
3usu_A256 Crystal Structure Of Butea Monosperma Seed Lectin L 1e-08
3ipv_B239 Crystal Structure Of Spatholobus Parviflorus Seed L 1e-08
3usu_B242 Crystal Structure Of Butea Monosperma Seed Lectin L 1e-08
1wbf_A242 Winged Bean Lectin, Saccharide Free Form Length = 2 6e-08
2e7q_A237 Crystal Structure Of Basic Winged Bean Lectin In Co 6e-08
1wbl_A241 Winged Bean Lectin Complexed With Methyl-Alpha-D-Ga 7e-08
1qnw_A242 Lectin Ii From Ulex Europaeus Length = 242 1e-07
2fmd_A240 Structural Basis Of Carbohydrate Recognition By Bow 2e-07
1n3o_A252 Pterocarcpus Angolensis Lectin In Complex With Alph 2e-07
1q8o_A252 Pterocartpus Angolensis Lectin Pal In Complex With 2e-07
1sfy_A239 Crystal Structure Of Recombinant Erythrina Corallod 1e-06
1lte_A239 Structure Of A Legume Lectin With An Ordered N-Link 1e-06
1gz9_A239 High-Resolution Crystal Structure Of Erythrina Cris 1e-06
1ax0_A239 Erythrina Corallodendron Lectin In Complex With N-A 2e-06
3n35_A242 Erythrina Corallodendron Lectin Mutant (Y106g) With 3e-06
1uzy_A242 Erythrina Crystagalli Lectin Length = 242 3e-06
1fyu_A255 Crystal Structure Of Erythrina Corallodendron Lecti 3e-06
2zbj_A 237 Crystal Structure Of Dioclea Rostrata Lectin Length 8e-06
2ovu_A 237 Crystal Strucure Of A Lectin From Canavalia Gladiat 1e-05
2je9_A 239 Crystal Structure Of Recombinant Dioclea Grandiflor 1e-05
1mvq_A 236 Cratylia Mollis Lectin (Isoform 1) In Complex With 1e-05
2jec_A 239 Crystal Structure Of Recombinant Dioclea Grandiflor 1e-05
2gdf_A 237 Crystal Structure Of Dioclea Violacea Seed Lectin L 2e-05
3sh3_A 237 Crystal Structure Of A Pro-Inflammatory Lectin From 2e-05
1avb_A226 Arcelin-1 From Phaseolus Vulgaris L Length = 226 2e-05
1wuv_A 237 Crystal Structure Of Native Canavalia Gladiata Lect 2e-05
1cn1_A 237 Crystal Structure Of Demetallized Concanavalin A. T 3e-05
2cna_A 237 The Covalent And Three-Dimensional Structure Of Con 3e-05
1qmo_E133 Structure Of Fril, A Legume Lectin That Delays Hema 3e-05
3u4x_A 236 Crystal Structure Of A Lectin From Camptosema Pedic 3e-05
1fny_A237 Legume Lectin Of The Bark Of Robinia Pseudoacacia. 5e-05
2d3p_A 236 Cratylia Floribunda Seed Lectin Crystallized At Bas 5e-05
1dgl_A 237 Lectin From Dioclea Grandiflora Complexed To Triman 6e-05
1h9p_A 237 Crystal Structure Of Dioclea Guianensis Seed Lectin 6e-05
3rrd_A 237 Native Structure Of Dioclea Virgata Lectin Length = 6e-05
1h9w_A 237 Native Dioclea Guianensis Seed Lectin Length = 237 6e-05
1azd_A 237 Concanavalin From Canavalia Brasiliensis Length = 2 7e-05
1dbn_A239 Maackia Amurensis Leukoagglutinin (Lectin) With Sia 9e-05
3a0k_A 237 Crystal Structure Of An Antiflamatory Legume Lectin 9e-05
1fay_A238 Winged Bean Acidic Lectin Complexed With Methyl-Alp 9e-05
2cwm_A 237 Native Crystal Structure Of No Releasing Inductive 1e-04
2ow4_A 237 Crystal Structure Of A Lectin From Canavalia Mariti 1e-04
2yz4_A 237 The Neutron Structure Of Concanavalin A At 2.2 Angs 1e-04
2ctv_A 237 High Resolution Crystallographic Studies Of Native 1e-04
2jdz_A 239 Crystal Structure Of Recombinant Dioclea Guianensis 1e-04
2je7_A 239 Crystal Structure Of Recombinant Dioclea Guianensis 1e-04
1dhk_B223 Structure Of Porcine Pancreatic Alpha-Amylase Lengt 1e-04
1viw_B205 Tenebrio Molitor Alpha-Amylase-Inhibitor Complex Le 3e-04
>pdb|3UJO|A Chain A, Galactose-Specific Seed Lectin From Dolichos Lablab In Complex With Adenine And Galactose Length = 281 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 65/121 (53%), Gaps = 10/121 (8%)
Query: 80  HQLAVELDTFKND-FDVDGNHVAIDTTSISQPVAVESLNSTGVDLKSGKNITVIIQYNGS 138
             +AVE DTF N  +D    H+ ID  SI      +S+ +T  D  +G+N  V+I Y+ S
Sbjct: 141 QTVAVEFDTFYNGGWDPTERHIGIDVNSI------KSIKTTSWDFANGENAEVLITYDSS 194
Query: 139 QNLIYVNVRDTDHPPKNVIKQPINLSDIVPSSVYVGFTAATG---ALAESHQLLEWSLTS 195
            NL+  ++         ++ + ++L+ ++P  V VGF+A TG      E++++L WS  S
Sbjct: 195 TNLLVASLVHPSQKTSFIVSERVDLTSVLPEWVSVGFSATTGLSKGYVETNEVLSWSFAS 254
Query: 196 Q 196
           +
Sbjct: 255 K 255
>pdb|2SBA|A Chain A, Soybean Agglutinin Complexed With 2,6-Pentasaccharide Length = 253 Back     alignment and structure
>pdb|1LUL|A Chain A, Db58, A Legume Lectin From Dolichos Biflorus Length = 253 Back     alignment and structure
>pdb|1G8W|A Chain A, Improved Structure Of Phytohemagglutinin-L From The Kidney Bean Length = 233 Back     alignment and structure
>pdb|1FAT|A Chain A, Phytohemagglutinin-L Length = 252 Back     alignment and structure
>pdb|2BQP|A Chain A, The Structure Of The Pea Lectin-D-Glucopyranose Complex Length = 234 Back     alignment and structure
>pdb|1N47|A Chain A, Isolectin B4 From Vicia Villosa In Complex With The Tn Antigen Length = 233 Back     alignment and structure
>pdb|1BJQ|A Chain A, The Dolichos Biflorus Seed Lectin In Complex With Adenine Length = 253 Back     alignment and structure
>pdb|3IPV|A Chain A, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 251 Back     alignment and structure
>pdb|3ZVX|A Chain A, Structure Of The Lectin From Platypodium Elegans In Complex With A Trimannoside Length = 261 Back     alignment and structure
>pdb|3USU|A Chain A, Crystal Structure Of Butea Monosperma Seed Lectin Length = 256 Back     alignment and structure
>pdb|3IPV|B Chain B, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 239 Back     alignment and structure
>pdb|3USU|B Chain B, Crystal Structure Of Butea Monosperma Seed Lectin Length = 242 Back     alignment and structure
>pdb|1WBF|A Chain A, Winged Bean Lectin, Saccharide Free Form Length = 242 Back     alignment and structure
>pdb|2E7Q|A Chain A, Crystal Structure Of Basic Winged Bean Lectin In Complex With B Blood Group Trisaccharide Length = 237 Back     alignment and structure
>pdb|1WBL|A Chain A, Winged Bean Lectin Complexed With Methyl-Alpha-D-Galactose Length = 241 Back     alignment and structure
>pdb|1QNW|A Chain A, Lectin Ii From Ulex Europaeus Length = 242 Back     alignment and structure
>pdb|2FMD|A Chain A, Structural Basis Of Carbohydrate Recognition By Bowringia Milbraedii Seed Agglutinin Length = 240 Back     alignment and structure
>pdb|1N3O|A Chain A, Pterocarcpus Angolensis Lectin In Complex With Alpha-Methyl Glucose Length = 252 Back     alignment and structure
>pdb|1Q8O|A Chain A, Pterocartpus Angolensis Lectin Pal In Complex With The Dimmanoside Man(Alpha1-2)man Length = 252 Back     alignment and structure
>pdb|1SFY|A Chain A, Crystal Structure Of Recombinant Erythrina Corallodandron Lectin Length = 239 Back     alignment and structure
>pdb|1LTE|A Chain A, Structure Of A Legume Lectin With An Ordered N-Linked Carbohydrate In Complex With Lactose Length = 239 Back     alignment and structure
>pdb|1GZ9|A Chain A, High-Resolution Crystal Structure Of Erythrina Cristagalli Lectin In Complex With 2'-Alpha-L-Fucosyllactose Length = 239 Back     alignment and structure
>pdb|1AX0|A Chain A, Erythrina Corallodendron Lectin In Complex With N-Actylgalactosamine Length = 239 Back     alignment and structure
>pdb|3N35|A Chain A, Erythrina Corallodendron Lectin Mutant (Y106g) With N- Acetylgalactosamine Length = 242 Back     alignment and structure
>pdb|1UZY|A Chain A, Erythrina Crystagalli Lectin Length = 242 Back     alignment and structure
>pdb|1FYU|A Chain A, Crystal Structure Of Erythrina Corallodendron Lectin In Hexagonal Crystal Form Length = 255 Back     alignment and structure
>pdb|2ZBJ|A Chain A, Crystal Structure Of Dioclea Rostrata Lectin Length = 237 Back     alignment and structure
>pdb|2OVU|A Chain A, Crystal Strucure Of A Lectin From Canavalia Gladiata (Cgl) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|2JE9|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|1MVQ|A Chain A, Cratylia Mollis Lectin (Isoform 1) In Complex With Methyl-Alpha-D- Mannose Length = 236 Back     alignment and structure
>pdb|2JEC|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Mutant E123a-H131n-K132q Complexed With 5-Bromo-4-Chloro-3- Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2GDF|A Chain A, Crystal Structure Of Dioclea Violacea Seed Lectin Length = 237 Back     alignment and structure
>pdb|3SH3|A Chain A, Crystal Structure Of A Pro-Inflammatory Lectin From The Seeds Of Dioclea Wilsonii Standl Length = 237 Back     alignment and structure
>pdb|1AVB|A Chain A, Arcelin-1 From Phaseolus Vulgaris L Length = 226 Back     alignment and structure
>pdb|1WUV|A Chain A, Crystal Structure Of Native Canavalia Gladiata Lectin (Cgl): A Tetrameric Cona-Like Lectin Length = 237 Back     alignment and structure
>pdb|1CN1|A Chain A, Crystal Structure Of Demetallized Concanavalin A. The Metal- Binding Region Length = 237 Back     alignment and structure
>pdb|2CNA|A Chain A, The Covalent And Three-Dimensional Structure Of Concanavalin A, Iv.Atomic Coordinates,Hydrogen Bonding,And Quaternary Structure Length = 237 Back     alignment and structure
>pdb|1QMO|E Chain E, Structure Of Fril, A Legume Lectin That Delays Hematopoietic Progenitor Maturation Length = 133 Back     alignment and structure
>pdb|3U4X|A Chain A, Crystal Structure Of A Lectin From Camptosema Pedicellatum Seeds In Complex With 5-Bromo-4-Chloro-3-Indolyl-Alpha-D-Mannose Length = 236 Back     alignment and structure
>pdb|1FNY|A Chain A, Legume Lectin Of The Bark Of Robinia Pseudoacacia. Length = 237 Back     alignment and structure
>pdb|2D3P|A Chain A, Cratylia Floribunda Seed Lectin Crystallized At Basic Ph Length = 236 Back     alignment and structure
>pdb|1DGL|A Chain A, Lectin From Dioclea Grandiflora Complexed To Trimannoside Length = 237 Back     alignment and structure
>pdb|1H9P|A Chain A, Crystal Structure Of Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|3RRD|A Chain A, Native Structure Of Dioclea Virgata Lectin Length = 237 Back     alignment and structure
>pdb|1H9W|A Chain A, Native Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|1AZD|A Chain A, Concanavalin From Canavalia Brasiliensis Length = 237 Back     alignment and structure
>pdb|1DBN|A Chain A, Maackia Amurensis Leukoagglutinin (Lectin) With Sialyllactose Length = 239 Back     alignment and structure
>pdb|3A0K|A Chain A, Crystal Structure Of An Antiflamatory Legume Lectin From Cymbosema Roseum Seeds Length = 237 Back     alignment and structure
>pdb|1FAY|A Chain A, Winged Bean Acidic Lectin Complexed With Methyl-Alpha-D-Galactose (Monoclinic Form) Length = 238 Back     alignment and structure
>pdb|2CWM|A Chain A, Native Crystal Structure Of No Releasing Inductive Lectin From Seeds Of The Canavalia Maritima (Conm) Length = 237 Back     alignment and structure
>pdb|2OW4|A Chain A, Crystal Structure Of A Lectin From Canavalia Maritima Seeds (Conm) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|2YZ4|A Chain A, The Neutron Structure Of Concanavalin A At 2.2 Angstroms Length = 237 Back     alignment and structure
>pdb|2CTV|A Chain A, High Resolution Crystallographic Studies Of Native Concanavalin A Using Rapid Laue Data Collection Methods And The Introduction Of A Monochromatic Large-Angle Oscillation Technique (Lot) Length = 237 Back     alignment and structure
>pdb|2JDZ|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2JE7|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin S131h Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|1DHK|B Chain B, Structure Of Porcine Pancreatic Alpha-Amylase Length = 223 Back     alignment and structure
>pdb|1VIW|B Chain B, Tenebrio Molitor Alpha-Amylase-Inhibitor Complex Length = 205 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 6e-25
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 1e-24
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 4e-24
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 4e-24
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 5e-24
1nls_A 237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 8e-24
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 8e-24
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 9e-24
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 3e-23
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 3e-23
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 8e-23
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 3e-22
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 5e-22
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 6e-22
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 9e-22
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 2e-21
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 3e-21
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 6e-21
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 8e-21
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 9e-21
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 1e-20
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 2e-19
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 3e-19
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 5e-17
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 6e-11
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 8e-10
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 1e-08
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 3e-08
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Length = 233 Back     alignment and structure
 Score = 96.4 bits (239), Expect = 6e-25
 Identities = 35/119 (29%), Positives = 57/119 (47%), Gaps = 9/119 (7%)

Query: 80  HQLAVELDTFKNDFDVDGNHVAIDTTSISQPVAVESLNSTGVDLKSGKNITVIIQYNGSQ 139
             +AVE DT+ N +D +  H+ IDT  I      ES  +T  D+  G+   ++I Y  S 
Sbjct: 118 QTVAVEFDTYSNAWDPNYTHIGIDTNGI------ESKKTTPFDMVYGEKANIVITYQAST 171

Query: 140 NLIYVNVRDTDHPPKNVIKQPINLSDIVPSSVYVGFTAATG---ALAESHQLLEWSLTS 195
             +  ++          +   ++L DI+P  V VGF+A TG    + E+H ++ WS   
Sbjct: 172 KALAASLVFPVSQTSYAVSARVDLRDILPEYVRVGFSATTGLNAGVVETHDIVSWSFAV 230
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Length = 242 Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Length = 253 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Length = 237 Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Length = 232 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Length = 251 Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Length = 253 Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Length = 239 Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Length = 252 Back     alignment and structure
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 133 Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Length = 240 Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Length = 242 Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Length = 239 Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Length = 242 Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Length = 234 Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Length = 234 Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Length = 238 Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 240 Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Length = 261 Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Length = 257 Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Length = 243 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Length = 223 Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 226 Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Length = 260 Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Length = 253 Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Length = 52 Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Length = 181 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 100.0
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 100.0
3ujo_A281 Legume lectin; carbohydrate-binding, galactose, ad 100.0
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 100.0
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 100.0
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 100.0
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 100.0
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 100.0
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 100.0
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 100.0
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 100.0
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 100.0
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 100.0
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 100.0
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 100.0
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 100.0
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 100.0
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 100.0
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 100.0
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 100.0
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 100.0
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 100.0
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 100.0
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 100.0
1nls_A 237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 100.0
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 100.0
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 99.96
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 99.95
2a6y_A256 EMP47P (FORM1); beta sandwich, carbohydrate bindin 99.75
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 99.61
2a6z_A222 EMP47P (FORM2); beta sandwich, carbohydrate bindin 99.23
1qmo_A113 Mannose binding lectin, FRIL; crosslink, hematopoi 99.13
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 98.98
2a6v_A226 EMP46P; beta sandwich, carbohydrate binding protei 98.0
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Back     alignment and structure
Probab=100.00  E-value=4.4e-52  Score=357.12  Aligned_cols=177  Identities=26%  Similarity=0.347  Sum_probs=153.7

Q ss_pred             eEEeeeeecCeEeccc-----cceeeEEe-eeeeeeCC--ccee-eee---ccCCCCCCCCCeeeeeccccccCCCCCcE
Q 040710           14 WRLFLHLIACPRQLSV-----LAHFSESW-INILKISD--RKRL-VSI---SSIRPLLYVANSLRVINYMLEIVGTDMHQ   81 (202)
Q Consensus        14 ~~~~~~~y~~p~~l~~-----~asFsT~F-F~i~~~~~--~~~~-~~~---~~~~P~~~~gg~LGL~~~~~~~~~~~n~~   81 (202)
                      .++|+|+|++|+|||+     ++||+|+| |+|.++..  ..++ |.+   +..+|.++.||+|||++....+....||+
T Consensus        54 ~s~Gra~Y~~Pv~l~d~~tg~vaSFsT~F~F~I~~~~~~~gdGlAF~lap~~~~~p~~~~g~~LGL~n~~~~g~~~~n~~  133 (261)
T 3zyr_A           54 STVGRILHSAQVRLWEKSTNRVANLQTQFSFFLSSPLSNPADGIAFFIAPPDTTIPSGSAGGLLGLFNPRTALNESANQV  133 (261)
T ss_dssp             SEEEEEEESSCEECBCTTTCCBEEEEEEEEEEEECSSSSCCCEEEEEEECTTCCCCTTCCGGGTTTCCTTTTTCGGGCCC
T ss_pred             CCEEEEEECCCEEeecCCCCCceeEEEEEEEEEecCCCCCCccEEEEEccCCCCCCCCCCCceeeeecccccCCCccCcE
Confidence            6889999999999998     89999999 99976522  1222 333   33468888899999998876543356899


Q ss_pred             EEEEEeCC---CC-CCCCCCCeEEEecCCCcCceeeeecCCCccccCCCceEEEEEEEcCCccEEEEEEeeCCCCCceee
Q 040710           82 LAVELDTF---KN-DFDVDGNHVAIDTTSISQPVAVESLNSTGVDLKSGKNITVIIQYNGSQNLIYVNVRDTDHPPKNVI  157 (202)
Q Consensus        82 vAVEFDT~---~n-~~Dp~~nHVgIdvns~~~S~~~~~~~~~~~~l~~G~~~~vwI~Yd~~~~~L~V~l~~~~kp~~plL  157 (202)
                      |||||||+   +| +|||++||||||||++. |.++.+|     .+.+|+.++|||+||+.+++|+|+|.+.. +++|+|
T Consensus       134 vAVEFDT~~~~~n~~~Dp~~nHVGIdvNsi~-S~~s~~~-----~l~~G~~~~v~I~Yd~~~~~L~V~l~~~~-~~~~~l  206 (261)
T 3zyr_A          134 LAVEFDTFFAQNSNTWDPNYQHIGIDVNSIR-SSKVVRW-----ERREGKTLNVLVTYNPSTRTIDVVATYPD-GQRYQL  206 (261)
T ss_dssp             EEEEEECCCCTTTCTTSCSSCEEEEEESSSS-CSEEEEC-----CCCTTCCEEEEEEEETTTTEEEEEEECTT-CCEEEE
T ss_pred             EEEEEeccccccCcCCCCCCCeEEEEcCCCC-ccccccc-----cccCCceEEEEEEEcCCCCEEEEEEEcCC-CCCeEE
Confidence            99999999   99 89999999999999999 9999888     46799999999999999999999999854 348999


Q ss_pred             eeeeccCCCCCCeEEEEEeeecCCCccceEEEEEEEeecC
Q 040710          158 KQPINLSDIVPSSVYVGFTAATGALAESHQLLEWSLTSQP  197 (202)
Q Consensus       158 s~~vdLs~~l~~~v~VGFSAsTG~~~~~h~I~sWsF~s~~  197 (202)
                      ++.+||+++|+|+|||||||+||...|.|+|++|+|+++.
T Consensus       207 s~~vdL~~~l~e~v~VGFSAsTG~~~e~h~IlsWsF~s~l  246 (261)
T 3zyr_A          207 SHVVDLTTILPEWVRVGFSAASGEQFQTHNLESWSFTSTL  246 (261)
T ss_dssp             EEECCGGGTSCSEEEEEEEEEESSSCCEEEEEEEEEEEEE
T ss_pred             EEEechHHhCcCcEEEEEEecCCCccceEEEEEEEEEEEc
Confidence            9999999999999999999999999999999999999873
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Back     alignment and structure
>3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Back     alignment and structure
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Back     alignment and structure
>2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Back     alignment and structure
>2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A Back     alignment and structure
>1qmo_A Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Back     alignment and structure
>2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 202
d2d3sa1237 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Pso 2e-29
d1gzca_239 b.29.1.1 (A:) Legume lectin {Cockspur coral tree ( 1e-28
d1nlsa_ 237 b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia 2e-28
d1g9fa_251 b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) 7e-28
d1f9ka_234 b.29.1.1 (A:) Legume lectin {Winged bean (Psophoca 9e-27
d1g8wa_233 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 5e-26
d1n47a_233 b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi 7e-26
d1qnwa_237 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 2e-25
d1g7ya_253 b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos 4e-25
d1ukga_241 b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero 6e-25
g1qmo.1230 b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich 1e-24
d1fnya_237 b.29.1.1 (A:) Legume lectin {Black locust (Robinia 2e-24
d1hqla_236 b.29.1.1 (A:) Legume lectin {Griffonia simplicifol 1e-23
d1fx5a_240 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 4e-23
d1leda_243 b.29.1.1 (A:) Legume lectin {West-central african 3e-22
g2ltn.1229 b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum 6e-22
d1v6ia_232 b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog 6e-22
d1avba_226 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 7e-22
d1dbna_239 b.29.1.1 (A:) Legume lectin {Maackia amurensis, le 8e-21
d1ioaa_228 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 8e-21
d1dhkb_204 b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar 2e-20
d1gv9a_228 b.29.1.13 (A:) Carbohydrate-recognition domain of 2e-15
d2a6va1218 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Bake 1e-09
d2a6za1221 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Bake 1e-06
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Length = 237 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Legume lectin
species: Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]

 Score =  106 bits (266), Expect = 2e-29
 Identities = 37/127 (29%), Positives = 61/127 (48%), Gaps = 13/127 (10%)

Query: 76  GTDMHQLAVELDTFKNDFDVDGNHVAIDTTSISQPVAVESLNSTGVDLKSGKNITVIIQY 135
            +    +AVE DTF+N +D    H+ ID  S+       S  +    L +G    V+I+Y
Sbjct: 113 LSPYPFVAVEFDTFRNTWDPQIPHIGIDVNSVI------STKTVPFTLDNGGIANVVIKY 166

Query: 136 NGSQNLIYVNVRDTDHPPKNVIKQPINLSDIVPSSVYVGFTAATGA-------LAESHQL 188
           + S  +++V +          I   ++L  ++P SV VGF+AATG          E+H +
Sbjct: 167 DASTKILHVVLVFPSLGTIYTIADIVDLKQVLPESVNVGFSAATGDPSGKQRNATETHDI 226

Query: 189 LEWSLTS 195
           L WS ++
Sbjct: 227 LSWSFSA 233
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Length = 239 Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Length = 237 Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 Back     information, alignment and structure
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Length = 236 Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Length = 240 Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Length = 243 Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 218 Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 221 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
d1hqla_236 Legume lectin {Griffonia simplicifolia, lectin I-b 100.0
d1leda_243 Legume lectin {West-central african legume (Griffo 100.0
d1fx5a_240 Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI 100.0
d1gzca_239 Legume lectin {Cockspur coral tree (Erythrina cris 100.0
d2d3sa1237 Legume lectin {Winged bean (Psophocarpus tetragono 100.0
d1qnwa_237 Legume lectin {Furze (Ulex europaeus), UEA-II [Tax 100.0
d1f9ka_234 Legume lectin {Winged bean (Psophocarpus tetragono 100.0
d1g9fa_251 Legume lectin {Soybean (Glycine max) [TaxId: 3847] 100.0
d1g7ya_253 Legume lectin {Horse gram (Dolichos biflorus), dif 100.0
d1g8wa_233 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
d1ukga_241 Legume lectin {Bloodwood tree (Pterocarpus angolen 100.0
d1n47a_233 Legume lectin {Hairy vetch (Vicia villosa), isolec 100.0
d1dbna_239 Legume lectin {Maackia amurensis, leukoagglutinin 100.0
d1fnya_237 Legume lectin {Black locust (Robinia pseudoacacia) 100.0
g1qmo.1230 Legume lectin {Field bean (Dolichos lablab), Fril 100.0
d1v6ia_232 Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 100.0
g2ltn.1229 Legume lectin {Garden pea (Pisum sativum) [TaxId: 100.0
d1ioaa_228 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
d1avba_226 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
d1dhkb_204 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
d1nlsa_ 237 Concanavalin A {Jack bean (Canavalia ensiformis) [ 100.0
d1gv9a_228 Carbohydrate-recognition domain of P58/ERGIC-53 {R 99.86
d2a6za1221 Emp47p N-terminal domain {Baker's yeast (Saccharom 99.49
d2a6va1218 Emp46p N-terminal domain {Baker's yeast (Saccharom 99.38
d1nlsa_237 Concanavalin A {Jack bean (Canavalia ensiformis) [ 98.93
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Legume lectin
species: Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]

Probab=100.00  E-value=2.5e-48  Score=327.50  Aligned_cols=180  Identities=24%  Similarity=0.348  Sum_probs=153.6

Q ss_pred             ceEEeeeeecCeEeccc-----cceeeEEe-eeeeeeCCcc--ee-eee-ccCCCCCCCCCeeeeeccccccCCCCCcEE
Q 040710           13 GWRLFLHLIACPRQLSV-----LAHFSESW-INILKISDRK--RL-VSI-SSIRPLLYVANSLRVINYMLEIVGTDMHQL   82 (202)
Q Consensus        13 g~~~~~~~y~~p~~l~~-----~asFsT~F-F~i~~~~~~~--~~-~~~-~~~~P~~~~gg~LGL~~~~~~~~~~~n~~v   82 (202)
                      -|++++|+|++|||||+     ++||+|+| |.|....+..  +. |.+ +...+....|++|||++....+....+++|
T Consensus        43 ~~s~Gra~y~~Pv~l~~~~t~~~asFsT~F~F~i~~~~~~~gDGlAFvl~p~~~~~~~~G~~lGl~~~~~~~~~~~~~~v  122 (236)
T d1hqla_          43 QWSAGRALYSDPVQLWDNKTESVASFYTEFTFFLKITGNGPADGLAFFLAPPDSDVKDAGEYLGLFNKSTATQPSKNQVV  122 (236)
T ss_dssp             SSCEEEEEESSCEECCCSTTCCCCEEEEEEEEEEEECSSCCCCEEEEEEECTTCCCCCCGGGTTTSCTTTTTCGGGCCCE
T ss_pred             ccceEEEEECCCEEeecCCCCceeEEEEEEEEEEeCCCCCCCceEEEEEeCCCCCCCCCccccccccccccCCcccCceE
Confidence            46789999999999998     79999999 9996543322  22 222 344555567899999988776555678999


Q ss_pred             EEEEeCCCC-CC-CCCCCeEEEecCCCcCceeeeecCCCccccCCCceEEEEEEEcCCccEEEEEEeeCCCCCceeeeee
Q 040710           83 AVELDTFKN-DF-DVDGNHVAIDTTSISQPVAVESLNSTGVDLKSGKNITVIIQYNGSQNLIYVNVRDTDHPPKNVIKQP  160 (202)
Q Consensus        83 AVEFDT~~n-~~-Dp~~nHVgIdvns~~~S~~~~~~~~~~~~l~~G~~~~vwI~Yd~~~~~L~V~l~~~~kp~~plLs~~  160 (202)
                      ||||||++| ++ ||++||||||+|++. |.++.++.  ..+|.+|+.++|||+||+.+|+|+|+|++. +|..|+|++.
T Consensus       123 AVEFDT~~n~~~~D~~~nHIgIdvns~~-s~~~~~~~--~~~l~~G~~~~v~I~Yd~~~~~L~V~l~~~-~~~~~~ls~~  198 (236)
T d1hqla_         123 AVEFDTWTNPNFPEPSYRHIGINVNSIV-SVATKRWE--DSDIFSGKIATARISYDGSAEILTVVLSYP-DGSDYILSHS  198 (236)
T ss_dssp             EEEEECSCCSSSCCCSSCEEEEEESSSS-CSEEEECC--HHHHTSCSCEEEEEEEETTTTEEEEEEEET-TTEEEEEEEE
T ss_pred             EEEeeCccCCCCCCCCCCEEEEEcCCcc-cccccccc--cccccCCCEEEEEEEEeCCCcEEEEEEecC-CCCCeeEEEE
Confidence            999999999 77 999999999999999 88888775  568899999999999999999999999974 5778999999


Q ss_pred             eccCCCCCCeEEEEEeeecCCC-ccceEEEEEEEeec
Q 040710          161 INLSDIVPSSVYVGFTAATGAL-AESHQLLEWSLTSQ  196 (202)
Q Consensus       161 vdLs~~l~~~v~VGFSAsTG~~-~~~h~I~sWsF~s~  196 (202)
                      |||+++|+++||||||||||.. .+.|+|++|+|++.
T Consensus       199 vdL~~~l~~~v~vGFSasTG~~~~~~h~I~sWsF~s~  235 (236)
T d1hqla_         199 VDMRQNLPESVRVGISASTGNNQFLTVYILSWRFSSN  235 (236)
T ss_dssp             CCGGGTSCSEEEEEEEEECCSCCCEEEEEEEEEEEEE
T ss_pred             eCHHHhCCCcEEEEEEeECCCCCceEEEEEEeEeEec
Confidence            9999999999999999999975 67799999999985
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Back     information, alignment and structure