Citrus Sinensis ID: 040731


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
ATPFLAGLAIAAAALAGRYGIQAWQAIKTRPPKPKIRKFYEGGFQTTMTKREAALILGVRENATPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTKGSGSAF
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccc
ATPFLAGLAIAAAALAGRYGIQAWQAIKTRPPKPKIRKFYEGGFQTTMTKREAALILGVRENATPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKD*************
xxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ATPFLAGLAIAAAALAGRYGIQAWQAIKTRPPKPKIRKFYEGGFQTTMTKREAALILGVRENATPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTKGSGSAF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial import inner membrane translocase subunit TIM14-1 Component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner.confidentQ8RV04
Mitochondrial import inner membrane translocase subunit TIM14 Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity.probableQ3ZBN8
Mitochondrial import inner membrane translocase subunit tim14 Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to stimulate activity of mtHSP70 (SSC1/sscA).probableQ4WI88

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GUZ, chain A
Confidence level:very confident
Coverage over the Query: 39-106
View the alignment between query and template
View the model in PyMOL