Citrus Sinensis ID: 040731


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
ATPFLAGLAIAAAALAGRYGIQAWQAIKTRPPKPKIRKFYEGGFQTTMTKREAALILGVRENATPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTKGSGSAF
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcHccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccccc
ATPFLAGLAIAAAALAGRYGIQAWqaiktrppkpkirkfyeggfQTTMTKREAALILGvrenatpdkvkEAHRRVMVanhpdaggshyLASKINEAKdvmlgktkgsgsaf
ATPFLAGLAIAAAALAGRYGIQAwqaiktrppkpkiRKFYEGGFQTTMTKREAALILGVRENATPDKVKEAHRRVMVAnhpdaggshyLASKINEAKDVMLGKtkgsgsaf
ATPFlaglaiaaaalagRYGIQAWQAiktrppkpkirkFYEGGFQTTMTKREAALILGVRENATPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTKGSGSAF
***FLAGLAIAAAALAGRYGIQAWQAIKTRPPKPKIRKFYEGGFQTTMTKREAALILGVR***************************************************
ATPFLAGLAIAAAALAGRYGIQ******************************AALILGVRENATPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKD*************
ATPFLAGLAIAAAALAGRYGIQAWQAIKTRPPKPKIRKFYEGGFQTTMTKREAALILGVRENATPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTKGSGSAF
ATPFLAGLAIAAAALAGRYGIQAWQAIKTRPPKPKIRKFYEGGFQTTMTKREAALILGVRENATPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGK********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ATPFLAGLAIAAAALAGRYGIQAWQAIKTRPPKPKIRKFYEGGFQTTMTKREAALILGVRENATPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTKGSGSAF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query111 2.2.26 [Sep-21-2011]
Q8RV04112 Mitochondrial import inne yes no 1.0 0.991 0.846 5e-51
Q9LYY2112 Mitochondrial import inne no no 1.0 0.991 0.783 2e-41
Q9SF33112 Mitochondrial import inne no no 0.846 0.839 0.808 4e-41
Q78YY6149 DnaJ homolog subfamily C yes no 0.891 0.664 0.481 2e-23
Q3ZBN8116 Mitochondrial import inne yes no 0.945 0.905 0.495 4e-23
Q5RF34116 Mitochondrial import inne yes no 0.945 0.905 0.495 5e-23
Q96DA6116 Mitochondrial import inne yes no 0.945 0.905 0.495 5e-23
Q5RCP4150 DnaJ homolog subfamily C no no 0.891 0.66 0.471 5e-22
Q9Y5T4150 DnaJ homolog subfamily C no no 0.891 0.66 0.471 6e-22
Q6PBT7115 Mitochondrial import inne no no 0.900 0.869 0.427 1e-20
>sp|Q8RV04|TI141_ARATH Mitochondrial import inner membrane translocase subunit TIM14-1 OS=Arabidopsis thaliana GN=TIM14-1 PE=3 SV=1 Back     alignment and function desciption
 Score =  199 bits (505), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 94/111 (84%), Positives = 103/111 (92%)

Query: 1   ATPFLAGLAIAAAALAGRYGIQAWQAIKTRPPKPKIRKFYEGGFQTTMTKREAALILGVR 60
           ATPF+AG+A+AA ALAGRYGIQAWQA K RPP+PKI+KFYEGGFQ TMTKREAALILGVR
Sbjct: 2   ATPFIAGVAVAATALAGRYGIQAWQAFKARPPRPKIKKFYEGGFQPTMTKREAALILGVR 61

Query: 61  ENATPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTKGSGSAF 111
           E+   +KVKEAHR+VMVANHPDAGGSH+LASKINEAKDVMLGKTK SGSAF
Sbjct: 62  ESVAAEKVKEAHRKVMVANHPDAGGSHFLASKINEAKDVMLGKTKNSGSAF 112




Component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LYY2|TI143_ARATH Mitochondrial import inner membrane translocase subunit TIM14-3 OS=Arabidopsis thaliana GN=TIM14-3 PE=3 SV=1 Back     alignment and function description
>sp|Q9SF33|TI142_ARATH Mitochondrial import inner membrane translocase subunit TIM14-2 OS=Arabidopsis thaliana GN=TIM14-2 PE=3 SV=1 Back     alignment and function description
>sp|Q78YY6|DJC15_MOUSE DnaJ homolog subfamily C member 15 OS=Mus musculus GN=Dnajc15 PE=2 SV=1 Back     alignment and function description
>sp|Q3ZBN8|TIM14_BOVIN Mitochondrial import inner membrane translocase subunit TIM14 OS=Bos taurus GN=DNAJC19 PE=3 SV=3 Back     alignment and function description
>sp|Q5RF34|TIM14_PONAB Mitochondrial import inner membrane translocase subunit TIM14 OS=Pongo abelii GN=DNAJC19 PE=3 SV=3 Back     alignment and function description
>sp|Q96DA6|TIM14_HUMAN Mitochondrial import inner membrane translocase subunit TIM14 OS=Homo sapiens GN=DNAJC19 PE=1 SV=3 Back     alignment and function description
>sp|Q5RCP4|DJC15_PONAB DnaJ homolog subfamily C member 15 OS=Pongo abelii GN=DNAJC15 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y5T4|DJC15_HUMAN DnaJ homolog subfamily C member 15 OS=Homo sapiens GN=DNAJC15 PE=1 SV=2 Back     alignment and function description
>sp|Q6PBT7|TIM14_DANRE Mitochondrial import inner membrane translocase subunit TIM14 OS=Danio rerio GN=dnajc19 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
18403957112 chaperone DnaJ-domain containing protein 1.0 0.991 0.846 2e-49
297823385112 DNAJ heat shock N-terminal domain-contai 1.0 0.991 0.819 2e-48
326498039112 predicted protein [Hordeum vulgare subsp 1.0 0.991 0.828 2e-48
224069344112 predicted protein [Populus trichocarpa] 1.0 0.991 0.792 1e-46
115471001114 Os07g0192300 [Oryza sativa Japonica Grou 1.0 0.973 0.801 4e-46
414876263112 TPA: import inner membrane translocase s 1.0 0.991 0.810 7e-46
356511849112 PREDICTED: mitochondrial import inner me 1.0 0.991 0.891 9e-46
195639528112 mitochondrial import inner membrane tran 1.0 0.991 0.801 1e-45
242052047112 hypothetical protein SORBIDRAFT_03g00540 1.0 0.991 0.801 3e-45
239985483112 mitochondrial import inner membrane tran 0.990 0.982 0.790 4e-45
>gi|18403957|ref|NP_565824.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|75330641|sp|Q8RV04.1|TI141_ARATH RecName: Full=Mitochondrial import inner membrane translocase subunit TIM14-1; AltName: Full=Chaperone DnaJ-domain containing protein 1 gi|20197532|gb|AAM15117.1| expressed protein [Arabidopsis thaliana] gi|20197993|gb|AAM15345.1| expressed protein [Arabidopsis thaliana] gi|21536803|gb|AAM61135.1| DNAJ protein-like [Arabidopsis thaliana] gi|110737575|dbj|BAF00729.1| hypothetical protein [Arabidopsis thaliana] gi|114050699|gb|ABI49499.1| At2g35795 [Arabidopsis thaliana] gi|330254068|gb|AEC09162.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  199 bits (505), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 94/111 (84%), Positives = 103/111 (92%)

Query: 1   ATPFLAGLAIAAAALAGRYGIQAWQAIKTRPPKPKIRKFYEGGFQTTMTKREAALILGVR 60
           ATPF+AG+A+AA ALAGRYGIQAWQA K RPP+PKI+KFYEGGFQ TMTKREAALILGVR
Sbjct: 2   ATPFIAGVAVAATALAGRYGIQAWQAFKARPPRPKIKKFYEGGFQPTMTKREAALILGVR 61

Query: 61  ENATPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTKGSGSAF 111
           E+   +KVKEAHR+VMVANHPDAGGSH+LASKINEAKDVMLGKTK SGSAF
Sbjct: 62  ESVAAEKVKEAHRKVMVANHPDAGGSHFLASKINEAKDVMLGKTKNSGSAF 112




Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297823385|ref|XP_002879575.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325414|gb|EFH55834.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|326498039|dbj|BAJ94882.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326498277|dbj|BAJ98566.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326507336|dbj|BAJ95745.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|224069344|ref|XP_002326335.1| predicted protein [Populus trichocarpa] gi|222833528|gb|EEE72005.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|115471001|ref|NP_001059099.1| Os07g0192300 [Oryza sativa Japonica Group] gi|113610635|dbj|BAF21013.1| Os07g0192300, partial [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|414876263|tpg|DAA53394.1| TPA: import inner membrane translocase subunit TIM14 [Zea mays] Back     alignment and taxonomy information
>gi|356511849|ref|XP_003524634.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-like [Glycine max] Back     alignment and taxonomy information
>gi|195639528|gb|ACG39232.1| mitochondrial import inner membrane translocase subunit TIM14 [Zea mays] Back     alignment and taxonomy information
>gi|242052047|ref|XP_002455169.1| hypothetical protein SORBIDRAFT_03g005400 [Sorghum bicolor] gi|241927144|gb|EES00289.1| hypothetical protein SORBIDRAFT_03g005400 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|239985483|ref|NP_001146932.1| mitochondrial import inner membrane translocase subunit TIM14 [Zea mays] gi|195605332|gb|ACG24496.1| mitochondrial import inner membrane translocase subunit TIM14 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
TAIR|locus:2828254112 AT2G35795 [Arabidopsis thalian 1.0 0.991 0.693 1.9e-35
TAIR|locus:2143488112 AT5G03030 "AT5G03030" [Arabido 1.0 0.991 0.657 1.2e-33
TAIR|locus:2075004112 AT3G09700 "AT3G09700" [Arabido 0.846 0.839 0.744 8.5e-33
UNIPROTKB|Q96DA6116 DNAJC19 "Mitochondrial import 0.603 0.577 0.611 8.3e-19
UNIPROTKB|F1SGA9116 DNAJC19 "Uncharacterized prote 0.603 0.577 0.611 8.3e-19
UNIPROTKB|Q3ZBN8116 DNAJC19 "Mitochondrial import 0.603 0.577 0.611 1.1e-18
ZFIN|ZDB-GENE-040801-216149 dnajc15 "DnaJ (Hsp40) homolog, 0.558 0.416 0.645 2.2e-18
MGI|MGI:1913398149 Dnajc15 "DnaJ (Hsp40) homolog, 0.810 0.604 0.453 4.6e-18
UNIPROTKB|A1A4R3149 DNAJC15 "Uncharacterized prote 0.603 0.449 0.582 9.5e-18
RGD|1307154149 Dnajc15 "DnaJ (Hsp40) homolog, 0.810 0.604 0.443 9.5e-18
TAIR|locus:2828254 AT2G35795 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 383 (139.9 bits), Expect = 1.9e-35, P = 1.9e-35
 Identities = 77/111 (69%), Positives = 81/111 (72%)

Query:     1 ATPFXXXXXXXXXXXXXRYGIQAWQAXXXXXXXXXXXXFYEGGFQTTMTKREAALILGVR 60
             ATPF             RYGIQAWQA            FYEGGFQ TMTKREAALILGVR
Sbjct:     2 ATPFIAGVAVAATALAGRYGIQAWQAFKARPPRPKIKKFYEGGFQPTMTKREAALILGVR 61

Query:    61 ENATPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTKGSGSAF 111
             E+   +KVKEAHR+VMVANHPDAGGSH+LASKINEAKDVMLGKTK SGSAF
Sbjct:    62 ESVAAEKVKEAHRKVMVANHPDAGGSHFLASKINEAKDVMLGKTKNSGSAF 112




GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=ISS
GO:0031072 "heat shock protein binding" evidence=IEA
TAIR|locus:2143488 AT5G03030 "AT5G03030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075004 AT3G09700 "AT3G09700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q96DA6 DNAJC19 "Mitochondrial import inner membrane translocase subunit TIM14" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGA9 DNAJC19 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBN8 DNAJC19 "Mitochondrial import inner membrane translocase subunit TIM14" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-216 dnajc15 "DnaJ (Hsp40) homolog, subfamily C, member 15" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1913398 Dnajc15 "DnaJ (Hsp40) homolog, subfamily C, member 15" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A1A4R3 DNAJC15 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1307154 Dnajc15 "DnaJ (Hsp40) homolog, subfamily C, member 15" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LYY2TI143_ARATHNo assigned EC number0.78371.00.9910nono
Q5RF34TIM14_PONABNo assigned EC number0.49550.94590.9051yesno
Q96DA6TIM14_HUMANNo assigned EC number0.49550.94590.9051yesno
P91454TIM14_CAEELNo assigned EC number0.47050.87380.8660yesno
Q5B4H1TIM14_EMENINo assigned EC number0.45540.89180.9428yesno
Q3ZBN8TIM14_BOVINNo assigned EC number0.49550.94590.9051yesno
Q4WI88TIM14_ASPFUNo assigned EC number0.46530.89180.9428yesno
Q54QN1TIM14_DICDINo assigned EC number0.40360.92790.9115yesno
Q4I7T5TIM14_GIBZENo assigned EC number0.52320.73870.7809yesno
Q9SF33TI142_ARATHNo assigned EC number0.80850.84680.8392nono
Q8RV04TI141_ARATHNo assigned EC number0.84681.00.9910yesno
Q9VTJ8TIM14_DROMENo assigned EC number0.43750.90090.8474yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AT2G35795
DNAJ heat shock N-terminal domain-containing protein; DNAJ heat shock N-terminal domain-containing protein; FUNCTIONS IN- heat shock protein binding; INVOLVED IN- protein folding; LOCATED IN- cellular_component unknown; EXPRESSED IN- 22 plant structures; EXPRESSED DURING- 15 growth stages; CONTAINS InterPro DOMAIN/s- Heat shock protein DnaJ, N-terminal (InterPro-IPR001623); BEST Arabidopsis thaliana protein match is- DNAJ heat shock N-terminal domain-containing protein (TAIR-AT3G09700.1); Has 691 Blast hits to 691 proteins in 212 species- Archae - 0; Bacteria - 129; Metazoa - 169; Fung [...] (112 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
TXR1
TXR1 (THAXTOMIN A RESISTANT 1); mutant exhibited resistance to growth on media containing thaxt [...] (116 aa)
     0.929
AT5G61880
signaling molecule-related; signaling molecule-related; INVOLVED IN- biological_process unknown [...] (113 aa)
     0.922
AR192
AR192; adenyl-nucleotide exchange factor/ chaperone binding / protein binding / protein homodim [...] (327 aa)
      0.906
AT5G55200
co-chaperone grpE protein, putative; co-chaperone grpE protein, putative; FUNCTIONS IN- ATP bin [...] (302 aa)
      0.904
AT3G09700
DNAJ heat shock N-terminal domain-containing protein; DNAJ heat shock N-terminal domain-contain [...] (112 aa)
   0.903
AT5G03030
DNAJ heat shock N-terminal domain-containing protein; DNAJ heat shock N-terminal domain-contain [...] (112 aa)
   0.903
ATTIM17-1
ATTIM17-1; P-P-bond-hydrolysis-driven protein transmembrane transporter/ protein transporter; m [...] (218 aa)
      0.902
TIM50
TIM50; component of a translocase in the mitochondrial inner membrane ; Essential component of [...] (376 aa)
      0.902
TIM17-3
ATTIM17-3; P-P-bond-hydrolysis-driven protein transmembrane transporter/ protein transporter; m [...] (133 aa)
      0.902
ATTIM17-2
ATTIM17-2; P-P-bond-hydrolysis-driven protein transmembrane transporter/ protein transporter; M [...] (243 aa)
      0.900

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
PTZ00100116 PTZ00100, PTZ00100, DnaJ chaperone protein; Provis 3e-23
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 3e-07
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 6e-07
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 2e-06
pfam0022663 pfam00226, DnaJ, DnaJ domain 5e-06
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 8e-05
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 2e-04
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 3e-04
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 6e-04
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 7e-04
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 0.001
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 0.001
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 0.001
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 0.003
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 0.003
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 0.004
>gnl|CDD|240265 PTZ00100, PTZ00100, DnaJ chaperone protein; Provisional Back     alignment and domain information
 Score = 86.1 bits (213), Expect = 3e-23
 Identities = 39/119 (32%), Positives = 63/119 (52%), Gaps = 25/119 (21%)

Query: 3   PFLAGLAIAAAALAGRYGIQAWQ-------------------AIKTRPPKPKIRKFYEGG 43
           P +A L      LA RYG +  +                   ++ +   K  ++     G
Sbjct: 4   PIVA-LTFGGGVLAVRYGYRYLKNQKIFGSNNMSFPLSGFNPSLGSLFLKNDLK-----G 57

Query: 44  FQTTMTKREAALILGVRENATPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLG 102
           F+  M+K EA  IL +   A+ ++++EAH+++M+ NHPD GGS Y+ASK+NEAKD++L 
Sbjct: 58  FENPMSKSEAYKILNISPTASKERIREAHKQLMLRNHPDNGGSTYIASKVNEAKDLLLK 116


Length = 116

>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 111
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 99.93
PTZ00100116 DnaJ chaperone protein; Provisional 99.92
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 99.86
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.73
KOG3442132 consensus Uncharacterized conserved protein [Funct 99.67
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.67
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.66
PHA03102153 Small T antigen; Reviewed 99.65
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.63
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.61
PRK14296 372 chaperone protein DnaJ; Provisional 99.61
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.59
PRK14279 392 chaperone protein DnaJ; Provisional 99.58
PRK14288 369 chaperone protein DnaJ; Provisional 99.57
PRK14286 372 chaperone protein DnaJ; Provisional 99.57
PRK14282 369 chaperone protein DnaJ; Provisional 99.55
PRK14287 371 chaperone protein DnaJ; Provisional 99.55
PRK14299 291 chaperone protein DnaJ; Provisional 99.54
PRK14285 365 chaperone protein DnaJ; Provisional 99.53
PRK14276 380 chaperone protein DnaJ; Provisional 99.53
PRK10767 371 chaperone protein DnaJ; Provisional 99.52
PRK14301 373 chaperone protein DnaJ; Provisional 99.51
PRK14295 389 chaperone protein DnaJ; Provisional 99.51
PRK14280 376 chaperone protein DnaJ; Provisional 99.51
PRK14294 366 chaperone protein DnaJ; Provisional 99.51
PRK14283 378 chaperone protein DnaJ; Provisional 99.51
PRK14298 377 chaperone protein DnaJ; Provisional 99.51
PRK14297 380 chaperone protein DnaJ; Provisional 99.51
PRK14278 378 chaperone protein DnaJ; Provisional 99.5
PRK14281 397 chaperone protein DnaJ; Provisional 99.5
PRK14277 386 chaperone protein DnaJ; Provisional 99.49
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.49
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.49
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.49
PRK14291 382 chaperone protein DnaJ; Provisional 99.47
PRK14300 372 chaperone protein DnaJ; Provisional 99.46
PRK14290 365 chaperone protein DnaJ; Provisional 99.44
PHA02624 647 large T antigen; Provisional 99.44
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.44
PRK14284 391 chaperone protein DnaJ; Provisional 99.43
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.43
PRK14289 386 chaperone protein DnaJ; Provisional 99.43
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.42
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.42
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.41
PRK14292 371 chaperone protein DnaJ; Provisional 99.41
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.34
PRK14293 374 chaperone protein DnaJ; Provisional 99.33
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.29
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.29
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.27
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.23
PRK05014171 hscB co-chaperone HscB; Provisional 99.22
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.21
PRK01356166 hscB co-chaperone HscB; Provisional 99.2
PRK00294173 hscB co-chaperone HscB; Provisional 99.17
PRK03578176 hscB co-chaperone HscB; Provisional 99.17
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 99.13
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.03
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 99.0
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.99
PRK01773173 hscB co-chaperone HscB; Provisional 98.91
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.82
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.74
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 98.7
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.69
KOG1150 250 consensus Predicted molecular chaperone (DnaJ supe 98.65
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 98.37
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.09
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.55
PF1344662 RPT: A repeated domain in UCH-protein 97.22
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 96.96
KOG0431453 consensus Auxilin-like protein and related protein 96.48
PF11833 194 DUF3353: Protein of unknown function (DUF3353); In 95.16
COG1076 174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 92.64
PF14687112 DUF4460: Domain of unknown function (DUF4460) 89.7
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.93  E-value=5.1e-25  Score=145.40  Aligned_cols=105  Identities=60%  Similarity=0.940  Sum_probs=98.8

Q ss_pred             ChhHHHHHHHHHHHHHHHHHHH----HHHHHHhCCCCchhhhhhhcCCCCCCCHHHHHHHcCCCCCCCHHHHHHHHHHHH
Q 040731            1 ATPFLAGLAIAAAALAGRYGIQ----AWQAIKTRPPKPKIRKFYEGGFQTTMTKREAALILGVRENATPDKVKEAHRRVM   76 (111)
Q Consensus         1 ~~~~i~~l~i~~~~~~~r~~~~----a~~~~~~~~~~~~~~~~~~~~~~~~m~~~ea~~iLgl~~~~s~~eIk~~yr~l~   76 (111)
                      +.|+++|+.|....+-+|.+++    +||.+...+.+.....||++||+..|+..||-.||||++..+++.||+++|+.+
T Consensus         2 ~~~i~~G~gvaa~a~ag~~gl~~~~~~~qa~~~~~~~~~~~~~y~GGF~~kMsr~EA~lIL~v~~s~~k~KikeaHrriM   81 (112)
T KOG0723|consen    2 VSPIIAGLGVAALAFAGRYGLWMKTLAKQAFKTLPKGPFFGAFYKGGFEPKMSRREAALILGVTPSLDKDKIKEAHRRIM   81 (112)
T ss_pred             chhHHHhHHHHHHHHhchhhhhchhHHHHHHHHcCCCcchhhhhhcccccccchHHHHHHhCCCccccHHHHHHHHHHHH
Confidence            4789999999999999999999    888888888778888999999999999999999999999999999999999999


Q ss_pred             HhcCCCCCCCHHHHHHHHHHHHHhcCCCC
Q 040731           77 VANHPDAGGSHYLASKINEAKDVMLGKTK  105 (111)
Q Consensus        77 ~~~HPDk~g~~~~~~~i~~Ay~~L~~~~~  105 (111)
                      ..||||++||+|...+||+|+++|.....
T Consensus        82 ~~NHPD~GGSPYlAsKINEAKdlLe~~~~  110 (112)
T KOG0723|consen   82 LANHPDRGGSPYLASKINEAKDLLEGTSL  110 (112)
T ss_pred             HcCCCcCCCCHHHHHHHHHHHHHHhcccc
Confidence            99999999999999999999999986543



>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3442 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
2guz_A71 Structure Of The Tim14-tim16 Complex Of The Mitocho 5e-15
>pdb|2GUZ|A Chain A, Structure Of The Tim14-tim16 Complex Of The Mitochondrial Protein Import Motor Length = 71 Back     alignment and structure

Iteration: 1

Score = 75.9 bits (185), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 35/63 (55%), Positives = 45/63 (71%), Gaps = 1/63 (1%) Query: 39 FYEGGFQTTMTKREAALILGVRENA-TPDKVKEAHRRVMVANHPDAGGSHYLASKINEAK 97 F +GGF M +EA IL + EN T K+KE HR++M+ANHPD GGS +LA+KINEAK Sbjct: 2 FLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAK 61 Query: 98 DVM 100 D + Sbjct: 62 DFL 64

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
2guz_A71 Mitochondrial import inner membrane translocase su 5e-31
2guz_B65 Mitochondrial import inner membrane translocase su 5e-21
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 1e-06
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 8e-06
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 1e-05
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 1e-04
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 2e-04
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 2e-04
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 3e-04
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 5e-04
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 5e-04
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 5e-04
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 7e-04
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
 Score =  103 bits (260), Expect = 5e-31
 Identities = 35/68 (51%), Positives = 46/68 (67%), Gaps = 1/68 (1%)

Query: 39  FYEGGFQTTMTKREAALILGVRENA-TPDKVKEAHRRVMVANHPDAGGSHYLASKINEAK 97
           F +GGF   M  +EA  IL + EN  T  K+KE HR++M+ANHPD GGS +LA+KINEAK
Sbjct: 2   FLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAK 61

Query: 98  DVMLGKTK 105
           D +  +  
Sbjct: 62  DFLEKRGI 69


>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 65 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
2guz_A71 Mitochondrial import inner membrane translocase su 99.88
2guz_B65 Mitochondrial import inner membrane translocase su 99.8
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.77
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.72
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.71
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.7
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.68
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.68
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.67
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.67
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.66
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.66
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.65
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.65
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.64
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.64
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.63
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.62
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.62
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.6
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.6
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.57
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.56
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.55
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.5
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.47
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.46
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.44
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.43
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.41
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.41
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.4
3uo3_A 181 J-type CO-chaperone JAC1, mitochondrial; structura 99.28
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.17
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.4
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.88  E-value=7.4e-23  Score=126.25  Aligned_cols=68  Identities=50%  Similarity=0.810  Sum_probs=64.2

Q ss_pred             hhhcCCCCCCCHHHHHHHcCCCC-CCCHHHHHHHHHHHHHhcCCCCCCCHHHHHHHHHHHHHhcCCCCC
Q 040731           39 FYEGGFQTTMTKREAALILGVRE-NATPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTKG  106 (111)
Q Consensus        39 ~~~~~~~~~m~~~ea~~iLgl~~-~~s~~eIk~~yr~l~~~~HPDk~g~~~~~~~i~~Ay~~L~~~~~r  106 (111)
                      |+.++++..|+.+++|+||||++ +++.++|+++||+|++++|||++|+++.|++|++||++|.++..|
T Consensus         2 ~~~g~~~~~m~~~~~y~iLgl~~~~a~~~eIk~ayr~l~~~~HPDk~g~~~~f~~i~~Aye~L~~~~~r   70 (71)
T 2guz_A            2 FLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGIS   70 (71)
T ss_dssp             CCCSCCCSSCCHHHHHHHTTCCTTTCCHHHHHHHHHHHHHHHCGGGTCCHHHHHHHHHHHHHHHHHCCC
T ss_pred             CcCCCCCCCCCHHHHHHHcCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHhhhhhc
Confidence            67889999999999999999999 799999999999999999999999999999999999999987554



>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 111
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-04
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 8e-04
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Large T antigen, the N-terminal J domain
species: Murine polyomavirus [TaxId: 10634]
 Score = 35.7 bits (82), Expect = 1e-04
 Identities = 13/58 (22%), Positives = 25/58 (43%), Gaps = 2/58 (3%)

Query: 50  KREAALILGVRENATPDK--VKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTK 105
           K     +L +      D   +++A+++  +  HPD GGSH L  ++N        +  
Sbjct: 10  KERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHALMQELNSLWGTFKTEVY 67


>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.76
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.73
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.65
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.6
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.6
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.47
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.43
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Large T antigen, the N-terminal J domain
species: Murine polyomavirus [TaxId: 10634]
Probab=99.76  E-value=1.4e-19  Score=112.40  Aligned_cols=58  Identities=21%  Similarity=0.278  Sum_probs=54.2

Q ss_pred             HHHHHHHcCCCCCC--CHHHHHHHHHHHHHhcCCCCCCCHHHHHHHHHHHHHhcCCCCCC
Q 040731           50 KREAALILGVRENA--TPDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVMLGKTKGS  107 (111)
Q Consensus        50 ~~ea~~iLgl~~~~--s~~eIk~~yr~l~~~~HPDk~g~~~~~~~i~~Ay~~L~~~~~r~  107 (111)
                      ..++|+||||++++  +.++|+++||++++++|||++|+++.|++||+||++|.++.+|.
T Consensus        10 ~~~~y~iLgl~~~~~~~~~~IkkaYr~l~~~~HPDk~g~~e~~~~in~Ay~~L~d~~~r~   69 (79)
T d1fafa_          10 KERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHALMQELNSLWGTFKTEVYNL   69 (79)
T ss_dssp             HHHHHHHHTCCSSSTTCHHHHHHHHHHHHHHSSGGGSCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHhCCCCCCCCCHHHHHHHHHHHHHHhCcccCCCHHHHHHHHHHHHHHCCHHHHH
Confidence            57999999999987  89999999999999999999999999999999999999987654



>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure