Citrus Sinensis ID: 040765


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
VSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKFNPERFSEGVSKASKNQISFFSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYIHAPTRGATVYPQHGANIILHKI
ccEEEEEcccccccccccEEEEcccEEEccEEEccccEEEEccEEEEccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHccEEEEcccccccccccEEEEEccccEEEEEEc
ccEEEEHHHHHccccccEEEEEcccEEEccEEEccccEEEEEEEEEccccccccccHHHccHHHccccccccccccccccccccHHHccccHHHHHHHHHHHHHHHHHHEEEEccccccccccEEEEEEcccccEEEEEcc
VSQILYEVLRlyspaplltranvkeiklgeivippgvslslpimlvhhdheywgddakkfnperfsegvskaSKNQISFfsfgwgpricigQNFALLESKLALAMILQKFTfqlsptyihaptrgatvypqhganiilhki
VSQILYEVLrlyspaplltrANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKFNPERFSEGVSKASKNQISFFSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYIHAPTRGATVYPQHGANIILHKI
VSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKFNPERFSEGVSKASKNQISFFSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYIHAPTRGATVYPQHGANIILHKI
***ILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKF**************NQISFFSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYIHAPTRGATVYPQHGANIIL***
VSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKFNPERFSEGVSKASKNQISFFSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYIHAPTRGATVYPQHGANIILHKI
VSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKFNPERFSEGVSKASKNQISFFSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYIHAPTRGATVYPQHGANIILHKI
VSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKFNPERFSEGVSKASKNQISFFSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYIHAPTRGATVYPQHGANIILHKI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKFNPERFSEGVSKASKNQISFFSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYIHAPTRGATVYPQHGANIILHKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query141 2.2.26 [Sep-21-2011]
Q9SHG5519 Cytochrome P450 72C1 OS=A no no 1.0 0.271 0.539 3e-43
Q05047524 Secologanin synthase OS=C N/A no 1.0 0.269 0.517 2e-40
O48786520 Cytochrome P450 734A1 OS= no no 1.0 0.271 0.496 7e-36
Q6Z6D6557 Cytochrome P450 734A2 OS= no no 1.0 0.253 0.457 1e-33
Q9ZW95512 Cytokinin hydroxylase OS= no no 0.957 0.263 0.442 2e-32
B9X287542 Cytochrome P450 734A6 OS= no no 0.985 0.256 0.471 5e-32
Q69XM6538 Cytochrome P450 734A4 OS= no no 0.978 0.256 0.452 5e-31
Q9FF18518 Cytokinin hydroxylase OS= no no 0.957 0.260 0.463 2e-30
Q8LIF2537 Cytochrome P450 734A5 OS= no no 1.0 0.262 0.450 1e-26
Q93VK5595 Protein LUTEIN DEFICIENT no no 0.964 0.228 0.369 1e-18
>sp|Q9SHG5|C72C1_ARATH Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 Back     alignment and function desciption
 Score =  173 bits (439), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 76/141 (53%), Positives = 107/141 (75%)

Query: 1   VSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKF 60
           V+ IL+EVLRLYSPA    R   +E+KL    +P GV +++P++LVHHD + WGDD K+F
Sbjct: 379 VTMILHEVLRLYSPAYFTCRITKQEVKLERFSLPEGVVVTIPMLLVHHDSDLWGDDVKEF 438

Query: 61  NPERFSEGVSKASKNQISFFSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYIH 120
            PERF+ GV+ A+K ++SF  F  GPR CIGQNF++L++KL LAM+LQ+F+ +LSP+Y H
Sbjct: 439 KPERFANGVAGATKGRLSFLPFSSGPRTCIGQNFSMLQAKLFLAMVLQRFSVELSPSYTH 498

Query: 121 APTRGATVYPQHGANIILHKI 141
           AP   AT +PQHGA++I+ K+
Sbjct: 499 APFPAATTFPQHGAHLIIRKL 519




Atypical cytochrome P450 involved in brassinosteroids (BRs) inactivation and regulation of BRs homeostasis. Does not possess carbon 26 hydroxylase activity and may inactivate BRs by hydroxylation of carbons other than C-26. Acts in association with CYP734A1 to inactivate BRs and modulate photomorphogenesis.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 Back     alignment and function description
>sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 Back     alignment and function description
>sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 Back     alignment and function description
>sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 Back     alignment and function description
>sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 Back     alignment and function description
>sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 Back     alignment and function description
>sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
164604828 518 cytochrome P450 [Coptis japonica var. di 1.0 0.272 0.680 5e-53
224119134 518 cytochrome P450 [Populus trichocarpa] gi 1.0 0.272 0.631 5e-50
356549730 486 PREDICTED: secologanin synthase-like [Gl 1.0 0.290 0.645 6e-50
225464379 388 PREDICTED: secologanin synthase-like [Vi 1.0 0.363 0.624 6e-50
225470619 515 PREDICTED: secologanin synthase [Vitis v 0.985 0.269 0.633 9e-50
296090067 550 unnamed protein product [Vitis vinifera] 0.985 0.252 0.633 9e-50
296090099178 unnamed protein product [Vitis vinifera] 1.0 0.792 0.624 9e-50
225470615 516 PREDICTED: secologanin synthase-like [Vi 1.0 0.273 0.652 1e-49
296090065 470 unnamed protein product [Vitis vinifera] 1.0 0.3 0.652 1e-49
224105979 518 cytochrome P450 [Populus trichocarpa] gi 1.0 0.272 0.631 1e-49
>gi|164604828|dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta] Back     alignment and taxonomy information
 Score =  212 bits (539), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 116/141 (82%)

Query: 1   VSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKF 60
           V+ ILYEVLRLY PA L+ R   K +KLGEI +P GV L++P +LVHHD E WG+DA+ F
Sbjct: 378 VTMILYEVLRLYPPAVLMARGTYKTMKLGEITLPAGVHLAMPTLLVHHDRELWGEDAEDF 437

Query: 61  NPERFSEGVSKASKNQISFFSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYIH 120
           NPERFS GVSKA+KNQ+SFF F WGPRICIGQNFALLESK+A+AMILQ+F+F+LS TY+H
Sbjct: 438 NPERFSGGVSKATKNQVSFFPFSWGPRICIGQNFALLESKMAIAMILQRFSFELSSTYVH 497

Query: 121 APTRGATVYPQHGANIILHKI 141
           AP    T+ PQHGA +ILHK+
Sbjct: 498 APYTVITLQPQHGAQLILHKL 518




Source: Coptis japonica var. dissecta

Species: Coptis japonica

Genus: Coptis

Family: Ranunculaceae

Order: Ranunculales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224119134|ref|XP_002331333.1| cytochrome P450 [Populus trichocarpa] gi|222873916|gb|EEF11047.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356549730|ref|XP_003543244.1| PREDICTED: secologanin synthase-like [Glycine max] Back     alignment and taxonomy information
>gi|225464379|ref|XP_002266550.1| PREDICTED: secologanin synthase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225470619|ref|XP_002263609.1| PREDICTED: secologanin synthase [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090067|emb|CBI39886.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090099|emb|CBI39918.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225470615|ref|XP_002263652.1| PREDICTED: secologanin synthase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090065|emb|CBI39884.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224105979|ref|XP_002333744.1| cytochrome P450 [Populus trichocarpa] gi|222838385|gb|EEE76750.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
TAIR|locus:2089621512 CYP72A14 ""cytochrome P450, fa 1.0 0.275 0.617 2.6e-47
TAIR|locus:2089521512 CYP72A15 ""cytochrome P450, fa 1.0 0.275 0.609 2.6e-47
TAIR|locus:2089546508 CYP72A9 ""cytochrome P450, fam 1.0 0.277 0.581 2.3e-46
TAIR|locus:2089561514 CYP72A10 ""cytochrome P450, fa 1.0 0.274 0.617 1.3e-45
TAIR|locus:2089596512 CYP72A13 ""cytochrome P450, fa 1.0 0.275 0.602 1.3e-45
TAIR|locus:2089586512 CYP72A11 ""cytochrome P450, fa 1.0 0.275 0.595 1.2e-44
TAIR|locus:2089526512 CYP72A7 ""cytochrome P450, fam 1.0 0.275 0.602 1.5e-44
TAIR|locus:2089531515 CYP72A8 ""cytochrome P450, fam 1.0 0.273 0.563 1.4e-41
TAIR|locus:2043823520 BAS1 "PHYB ACTIVATION TAGGED S 1.0 0.271 0.496 2.2e-34
TAIR|locus:2149423525 CYP714A2 "cytochrome P450, fam 0.964 0.259 0.485 2.5e-33
TAIR|locus:2089621 CYP72A14 ""cytochrome P450, family 72, subfamily A, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 495 (179.3 bits), Expect = 2.6e-47, P = 2.6e-47
 Identities = 87/141 (61%), Positives = 117/141 (82%)

Query:     1 VSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKF 60
             ++ ILYEVLRLY P   LTRA  KE+KLG++ +P GV +SLP++LVH D E WG+DA +F
Sbjct:   372 MTMILYEVLRLYPPVVQLTRAIHKEMKLGDLTLPGGVQISLPVLLVHRDTELWGNDAGEF 431

Query:    61 NPERFSEGVSKASKNQISFFSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYIH 120
              PERF +G+SKA+KNQ+SFF F WGPRICIGQNF LLE+K+A+++ILQ+F+F+LSP+Y+H
Sbjct:   432 KPERFKDGLSKATKNQVSFFPFAWGPRICIGQNFTLLEAKMAMSLILQRFSFELSPSYVH 491

Query:   121 APTRGATVYPQHGANIILHKI 141
             AP    T+YPQ GA+++LHK+
Sbjct:   492 APYTIITLYPQFGAHLMLHKL 512




GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0000041 "transition metal ion transport" evidence=RCA
TAIR|locus:2089521 CYP72A15 ""cytochrome P450, family 72, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089546 CYP72A9 ""cytochrome P450, family 72, subfamily A, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089561 CYP72A10 ""cytochrome P450, family 72, subfamily A, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089596 CYP72A13 ""cytochrome P450, family 72, subfamily A, polypeptide 13"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089586 CYP72A11 ""cytochrome P450, family 72, subfamily A, polypeptide 11"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089526 CYP72A7 ""cytochrome P450, family 72, subfamily A, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089531 CYP72A8 ""cytochrome P450, family 72, subfamily A, polypeptide 8"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043823 BAS1 "PHYB ACTIVATION TAGGED SUPPRESSOR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149423 CYP714A2 "cytochrome P450, family 714, subfamily A, polypeptide 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
CYP72A43
cytochrome P450 (518 aa)
(Populus trichocarpa)
Predicted Functional Partners:
CYP728D10P
cytochrome P450 (151 aa)
       0.448

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 2e-40
pfam00067461 pfam00067, p450, Cytochrome P450 6e-32
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 3e-26
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 8e-23
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 5e-21
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 2e-12
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 4e-12
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 2e-11
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 1e-10
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 2e-10
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 3e-10
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 5e-10
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 6e-08
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 1e-07
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 2e-07
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 2e-07
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 2e-07
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 4e-07
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 2e-06
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 3e-06
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 5e-06
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 9e-05
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 3e-04
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 8e-04
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
 Score =  140 bits (355), Expect = 2e-40
 Identities = 61/138 (44%), Positives = 90/138 (65%), Gaps = 3/138 (2%)

Query: 1   VSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKF 60
           ++ ++ E LRLY PA LL R   ++IKLG++ IP G+S+ +P++ +HH  E WG DA +F
Sbjct: 377 LNMVINESLRLYPPATLLPRMAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDANEF 436

Query: 61  NPERFSEGVSKASKNQISFFSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYIH 120
           NP+RF+ G   A      F  F  GPR CIGQ FA++E+K+ LAM++ KF+F +S  Y H
Sbjct: 437 NPDRFA-GRPFAPGRH--FIPFAAGPRNCIGQAFAMMEAKIILAMLISKFSFTISDNYRH 493

Query: 121 APTRGATVYPQHGANIIL 138
           AP    T+ P++G  + L
Sbjct: 494 APVVVLTIKPKYGVQVCL 511


Length = 516

>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 141
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.97
PLN02648480 allene oxide synthase 99.96
PF12508200 DUF3714: Protein of unknown function (DUF3714) ; I 83.51
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=3.3e-41  Score=263.45  Aligned_cols=141  Identities=37%  Similarity=0.708  Sum_probs=129.6

Q ss_pred             CchhhhhhhcCCCCCCCceeeccccceec-CeEeCCCCEEEEcceecccCCCCcCCCCCCcccCCCCCCcccCCCCccce
Q 040765            1 VSQILYEVLRLYSPAPLLTRANVKEIKLG-EIVIPPGVSLSLPIMLVHHDHEYWGDDAKKFNPERFSEGVSKASKNQISF   79 (141)
Q Consensus         1 l~a~i~E~lRl~p~~~~~~r~~~~~~~i~-g~~ip~g~~v~~~~~~~~~d~~~~~~~p~~F~P~R~l~~~~~~~~~~~~~   79 (141)
                      |++||+|||||||++|.+.|.+.+|+.++ |+.||+|+.|.++++++|||+.+|++||++|+||||+++......+++.|
T Consensus       354 l~~vi~EsLRLyppvp~~~R~~~~d~~l~~g~~IPkG~~V~i~~~~~~r~~~~~~~dp~~F~PeRf~~~~~~~~~~~~~f  433 (497)
T KOG0157|consen  354 LEMVIKESLRLYPPVPLVARKATKDVKLPGGYTIPKGTNVLISIYALHRDPRVWGEDPEEFDPERFLDGEEKAKRHPFAF  433 (497)
T ss_pred             HHHHHHHHhccCCCCchhhcccCCCeEcCCCcEeCCCCEEEEehHHhccCccccCCChhhcCccccCCCCCcCCCCCccc
Confidence            47899999999999999999999999995 89999999999999999999999987999999999997544434567899


Q ss_pred             eeecCCCCCchhHHHHHHHHHHHHHHHHhhceeEeCCCcccCCCcceeeecCCCceEEEEEC
Q 040765           80 FSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYIHAPTRGATVYPQHGANIILHKI  141 (141)
Q Consensus        80 ~~Fg~G~r~C~G~~lA~~~~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~p~~~~~v~~~~r  141 (141)
                      +|||+|+|.|+|++||++||++++++|+++|+++++.+....+....+++|++|++|++++|
T Consensus       434 ipFsaGpR~CiG~~fA~lemKv~l~~ll~~f~~~~~~~~~~~~~~~~~l~~~~gl~v~~~~r  495 (497)
T KOG0157|consen  434 IPFSAGPRNCIGQKFAMLEMKVVLAHLLRRFRIEPVGGDKPKPVPELTLRPKNGLKVKLRPR  495 (497)
T ss_pred             cCCCCCcccchhHHHHHHHHHHHHHHHHHheEEEecCCCCceeeeEEEEEecCCeEEEEEeC
Confidence            99999999999999999999999999999999999877545667789999999999999987



>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PF12508 DUF3714: Protein of unknown function (DUF3714) ; InterPro: IPR022187 Proteins in this entry are designated TraM and are found in a proposed transfer region of a class of conjugative transposon found in the Bacteroides lineage Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 1e-16
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 1e-16
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 1e-16
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 2e-15
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 3e-15
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 3e-15
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 3e-15
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 3e-15
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 3e-15
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 3e-15
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 3e-15
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 3e-15
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-15
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 3e-15
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-15
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 3e-15
1fah_A471 Structure Of Cytochrome P450 Length = 471 3e-15
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 3e-15
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-15
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 3e-15
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 3e-15
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 3e-15
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 3e-15
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 3e-15
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 3e-15
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 3e-15
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 3e-15
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 3e-15
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 3e-15
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 4e-15
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 5e-15
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 5e-15
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 6e-15
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 6e-15
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 7e-15
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 7e-15
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 8e-15
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 9e-15
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 9e-15
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-14
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-14
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 2e-14
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 2e-14
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-14
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 8e-14
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 3e-13
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 5e-11
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 6e-11
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 6e-11
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 6e-11
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 6e-11
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 6e-11
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 6e-11
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 7e-11
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 1e-10
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 1e-10
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 1e-10
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 1e-10
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 2e-10
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 3e-10
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 5e-09
2jjn_A411 Structure Of Closed Cytochrome P450 Eryk Length = 4 5e-09
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 6e-09
2vrv_A431 Structure Of Histidine Tagged Cytochrome P450 Eryk 1e-08
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 4e-07
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 6e-07
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 2e-06
2wh8_A413 Interaction Of Mycobacterium Tuberculosis Cyp130 Wi 2e-06
2wgy_A413 Crystal Structure Of The G243a Mutant Of Cyp130 Fro 2e-06
1gwi_A411 The 1.92 A Structure Of Streptomyces Coelicolor A3( 2e-06
2uuq_A414 Crystal Structure Of Cyp130 From Mycobacterium Tube 2e-06
3r9c_A418 Crystal Structure Of Mycobacterium Smegmatis Cyp164 2e-06
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 3e-06
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 4e-06
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 4e-06
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 5e-06
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 6e-06
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 6e-06
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 7e-06
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 7e-06
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 7e-06
3abb_A408 Crystal Structure Of Cyp105d6 Length = 408 2e-05
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 4e-05
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 5e-05
1f4t_A368 Thermophilic P450: Cyp119 From Sulfolobus Solfactar 5e-05
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 5e-05
1io8_A368 Thermophilic Cytochrome P450 (Cyp119) From Sulfolob 5e-05
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 6e-05
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 6e-05
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 6e-05
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 7e-05
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 9e-05
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 1e-04
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 1e-04
1jio_A403 P450eryf/6deb Length = 403 1e-04
1jip_A403 P450eryf(A245s)KETOCONAZOLE Length = 403 1e-04
1z8q_A404 Ferrous Dioxygen Complex Of The A245t Cytochrome P4 1e-04
1z8p_A404 Ferrous Dioxygen Complex Of The A245s Cytochrome P4 1e-04
1z8o_A404 Ferrous Dioxygen Complex Of The Wild-Type Cytochrom 1e-04
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 1e-04
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 1e-04
1egy_A403 Cytochrome P450eryf With 9-Aminophenanthrene Bound 2e-04
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 2e-04
4dnz_A410 The Crystal Structures Of Cyp199a4 Length = 410 2e-04
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 2e-04
2fr7_A412 Crystal Structure Of Cytochrome P450 Cyp199a2 Lengt 2e-04
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-04
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-04
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 2e-04
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 3e-04
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 3e-04
4ep6_A392 Crystal Structure Of The Xpla Heme Domain In Comple 4e-04
2wiv_A394 Cytochrome-P450 Xpla Heme Domain P21 Length = 394 4e-04
3ejb_B404 Crystal Structure Of P450bioi In Complex With Tetra 6e-04
3p3l_A406 Crystal Structure Of The Cytochrome P450 Monooxygen 8e-04
3p3o_A416 Crystal Structure Of The Cytochrome P450 Monooxygen 8e-04
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure

Iteration: 1

Score = 81.6 bits (200), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 46/116 (39%), Positives = 68/116 (58%), Gaps = 8/116 (6%) Query: 1 VSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKF 60 + ++ E LRL+ A L R K++++ + IP GV + +P +H D +YW + +KF Sbjct: 335 LDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTE-PEKF 393 Query: 61 NPERFSEGVSKASKNQIS---FFSFGWGPRICIGQNFALLESKLALAMILQKFTFQ 113 PERFS K +K+ I + FG GPR CIG FAL+ KLAL +LQ F+F+ Sbjct: 394 LPERFS----KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFK 445
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|2JJN|A Chain A, Structure Of Closed Cytochrome P450 Eryk Length = 411 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|2VRV|A Chain A, Structure Of Histidine Tagged Cytochrome P450 Eryk In Complex With Inhibitor Clotrimazole (Clt) Length = 431 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|2WH8|A Chain A, Interaction Of Mycobacterium Tuberculosis Cyp130 With Heterocyclic Arylamines Length = 413 Back     alignment and structure
>pdb|2WGY|A Chain A, Crystal Structure Of The G243a Mutant Of Cyp130 From M. Tuberculosis Length = 413 Back     alignment and structure
>pdb|1GWI|A Chain A, The 1.92 A Structure Of Streptomyces Coelicolor A3(2) Cyp154c1: A New Monooxygenase That Functionalizes Macrolide Ring Systems Length = 411 Back     alignment and structure
>pdb|2UUQ|A Chain A, Crystal Structure Of Cyp130 From Mycobacterium Tuberculosis In The Ligand-Free Form Length = 414 Back     alignment and structure
>pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|3ABB|A Chain A, Crystal Structure Of Cyp105d6 Length = 408 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1F4T|A Chain A, Thermophilic P450: Cyp119 From Sulfolobus Solfactaricus With 4- Phenylimidazole Bound Length = 368 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|1IO8|A Chain A, Thermophilic Cytochrome P450 (Cyp119) From Sulfolobus Solfataricus: High Resolution Structural Origin Of Its Thermostability And Functional Properties Length = 368 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|1JIO|A Chain A, P450eryf/6deb Length = 403 Back     alignment and structure
>pdb|1JIP|A Chain A, P450eryf(A245s)KETOCONAZOLE Length = 403 Back     alignment and structure
>pdb|1Z8Q|A Chain A, Ferrous Dioxygen Complex Of The A245t Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|1Z8P|A Chain A, Ferrous Dioxygen Complex Of The A245s Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|1Z8O|A Chain A, Ferrous Dioxygen Complex Of The Wild-Type Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1EGY|A Chain A, Cytochrome P450eryf With 9-Aminophenanthrene Bound Length = 403 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|4DNZ|A Chain A, The Crystal Structures Of Cyp199a4 Length = 410 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|2FR7|A Chain A, Crystal Structure Of Cytochrome P450 Cyp199a2 Length = 412 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|4EP6|A Chain A, Crystal Structure Of The Xpla Heme Domain In Complex With Imidazole And Peg Length = 392 Back     alignment and structure
>pdb|2WIV|A Chain A, Cytochrome-P450 Xpla Heme Domain P21 Length = 394 Back     alignment and structure
>pdb|3EJB|B Chain B, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 404 Back     alignment and structure
>pdb|3P3L|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Wildtype) From Streptomyces Thioluteus Length = 406 Back     alignment and structure
>pdb|3P3O|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Ntermii) From Streptomyces Thioluteus Length = 416 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 7e-60
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 8e-60
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 5e-59
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 4e-46
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 6e-42
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 7e-41
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 1e-39
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 9e-39
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 1e-37
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 6e-34
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-33
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-32
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 7e-32
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 9e-32
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-30
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 3e-29
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 8e-27
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-26
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-21
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 5e-18
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 4e-17
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 6e-17
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 9e-17
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 9e-17
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-16
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 3e-16
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 4e-16
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-15
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 1e-14
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 1e-11
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 4e-10
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 6e-10
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 3e-09
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 3e-09
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 9e-09
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 1e-08
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 2e-08
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 2e-08
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 2e-08
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 2e-08
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 2e-08
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 4e-08
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 4e-08
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 4e-08
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 8e-08
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 9e-08
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 9e-08
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 1e-07
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 2e-07
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 3e-07
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 3e-07
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 4e-07
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 4e-07
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 5e-07
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 5e-07
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 5e-07
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 6e-07
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 6e-07
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 8e-07
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 8e-07
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 8e-07
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 1e-06
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 1e-06
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 2e-06
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 2e-06
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 2e-06
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 2e-06
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 3e-06
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 4e-06
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 4e-06
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 5e-06
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 7e-06
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 7e-06
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 8e-06
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 2e-05
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
 Score =  190 bits (484), Expect = 7e-60
 Identities = 46/140 (32%), Positives = 67/140 (47%), Gaps = 4/140 (2%)

Query: 1   VSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKF 60
           +SQ+L E LRLY PA    R   +E  +  + +P    L     ++     Y+ +D   F
Sbjct: 305 LSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYF-EDPLTF 363

Query: 61  NPERFSEGVSKASKNQISFFSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYIH 120
           NP+RF  G   A K + ++F F  G R CIGQ FA +E K+ +A +LQ+  F+L P    
Sbjct: 364 NPDRFGPG---APKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRF 420

Query: 121 APTRGATVYPQHGANIILHK 140
                AT+ P       L  
Sbjct: 421 GLQEQATLKPLDPVLCTLRP 440


>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.98
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.98
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.97
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.97
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.97
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.97
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.97
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.97
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.95
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
Probab=100.00  E-value=3.4e-40  Score=253.21  Aligned_cols=138  Identities=29%  Similarity=0.462  Sum_probs=125.5

Q ss_pred             CchhhhhhhcCCCCCCCceeeccccceecCeEeCCCCEEEEcceecccCCCCcCCCCCCcccCCCCCCcccCCCCcccee
Q 040765            1 VSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKFNPERFSEGVSKASKNQISFF   80 (141)
Q Consensus         1 l~a~i~E~lRl~p~~~~~~r~~~~~~~i~g~~ip~g~~v~~~~~~~~~d~~~~~~~p~~F~P~R~l~~~~~~~~~~~~~~   80 (141)
                      |+|||+|+||++|+++.++|.+.+|++++|+.||+|+.|.++.+++|+||++| +||++|+||||++++..  ..+..++
T Consensus       345 l~avi~E~lRl~p~~~~~~r~~~~d~~~~g~~ip~Gt~v~~~~~~~~~d~~~~-~~p~~F~PeRfl~~~~~--~~~~~~~  421 (482)
T 3k9v_A          345 LKACLKESMRLTPSVPFTTRTLDKPTVLGEYALPKGTVLTLNTQVLGSSEDNF-EDSHKFRPERWLQKEKK--INPFAHL  421 (482)
T ss_dssp             HHHHHHHHHHHSCSCCEEEEECSSCEEETTEEECTTCEEEEECSGGGGCTTTC-SSTTSCCGGGGTCTTSC--CCGGGCC
T ss_pred             HHHHHHHHhhcCCCCcCcccccCCceeeCCEEECCCCEEEEccccccCCCccC-CCcCccCccccCCCCCC--CCCcccc
Confidence            47999999999999998899999999999999999999999999999999999 89999999999976432  4567899


Q ss_pred             eecCCCCCchhHHHHHHHHHHHHHHHHhhceeEeCCCcccCCCcceeeecCCCceEEEEEC
Q 040765           81 SFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYIHAPTRGATVYPQHGANIILHKI  141 (141)
Q Consensus        81 ~Fg~G~r~C~G~~lA~~~~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~p~~~~~v~~~~r  141 (141)
                      |||.|+|.|+|++||.+|++++++.|+++|++++.++.........+..|.++++|++++|
T Consensus       422 pFg~G~r~C~G~~~A~~e~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~R  482 (482)
T 3k9v_A          422 PFGIGKRMCIGRRLAELQLHLALCWIIQKYDIVATDNEPVEMLHLGILVPSRELPIAFRPR  482 (482)
T ss_dssp             TTCCSTTSCSCHHHHHHHHHHHHHHHHHHEEEEESCCCCCCEEESSSEEESSSCCEEEEEC
T ss_pred             CCCCCCcCCccHHHHHHHHHHHHHHHHHhcEEeccCCCCcccccceeecCCCCcceEEeeC
Confidence            9999999999999999999999999999999998776544444567789999999999997



>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 141
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 1e-30
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 1e-26
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 1e-25
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 6e-24
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 2e-23
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-22
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-20
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 2e-20
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 5e-20
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 2e-19
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 7e-19
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 3e-17
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 6e-17
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 9e-17
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 1e-16
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 2e-16
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 4e-16
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 7e-15
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 7e-14
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 1e-13
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 1e-13
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  112 bits (279), Expect = 1e-30
 Identities = 46/142 (32%), Positives = 74/142 (52%), Gaps = 4/142 (2%)

Query: 1   VSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKF 60
           +  ++ E LRL+  A  L R   K++++  + IP GV + +P   +H D +YW  + +KF
Sbjct: 329 LDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYW-TEPEKF 387

Query: 61  NPERFSEGVSKASKNQISFFSFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYIH 120
            PERFS+  +K + +   +  FG GPR CIG  FAL+  KLAL  +LQ F+F+       
Sbjct: 388 LPERFSKK-NKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQI 446

Query: 121 APT--RGATVYPQHGANIILHK 140
                 G  + P+    + +  
Sbjct: 447 PLKLSLGGLLQPEKPVVLKVES 468


>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.98
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.97
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.97
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.97
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.96
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.96
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.96
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.96
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.96
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.96
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.95
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=6.7e-40  Score=248.27  Aligned_cols=139  Identities=32%  Similarity=0.587  Sum_probs=124.6

Q ss_pred             CchhhhhhhcCCCCCCCceeeccccceecCeEeCCCCEEEEcceecccCCCCcCCCCCCcccCCCCCCcccCCCCcccee
Q 040765            1 VSQILYEVLRLYSPAPLLTRANVKEIKLGEIVIPPGVSLSLPIMLVHHDHEYWGDDAKKFNPERFSEGVSKASKNQISFF   80 (141)
Q Consensus         1 l~a~i~E~lRl~p~~~~~~r~~~~~~~i~g~~ip~g~~v~~~~~~~~~d~~~~~~~p~~F~P~R~l~~~~~~~~~~~~~~   80 (141)
                      |+|||+|++|++|+++.+.|.+.+|+.++|+.||||+.|+++.+++|+||++| +||++|+||||++.+.+ ...+..|+
T Consensus       329 l~a~i~E~lRl~p~~~~~~r~~~~d~~~~g~~ipkGt~v~~~~~~~~~d~~~~-~dp~~F~PeRfl~~~~~-~~~~~~~~  406 (472)
T d1tqna_         329 LDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYW-TEPEKFLPERFSKKNKD-NIDPYIYT  406 (472)
T ss_dssp             HHHHHHHHHHHCCTTCCEEEECCSCEEETTEEECTTCEEEECHHHHHTCTTTS-SSTTSCCGGGGSTTTGG-GCCTTTSC
T ss_pred             ccceeeeccccCCcccccccccccCccccCceeCCCCEEEEechhhhcCchhC-CCccccCccccCCCCcc-cCCCceec
Confidence            47999999999999999999999999999999999999999999999999999 89999999999976543 24567899


Q ss_pred             eecCCCCCchhHHHHHHHHHHHHHHHHhhceeEeCCCcc--cCCCcceeeecCCCceEEEEEC
Q 040765           81 SFGWGPRICIGQNFALLESKLALAMILQKFTFQLSPTYI--HAPTRGATVYPQHGANIILHKI  141 (141)
Q Consensus        81 ~Fg~G~r~C~G~~lA~~~~~~~l~~ll~~f~~~~~~~~~--~~~~~~~~~~p~~~~~v~~~~r  141 (141)
                      |||+|+|.|+|+++|.+|++++++.|+++|+++++++..  .......++.|++++.|++++|
T Consensus       407 ~FG~G~r~C~G~~~A~~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~R  469 (472)
T d1tqna_         407 PFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESR  469 (472)
T ss_dssp             TTCCSTTSCTTHHHHHHHHHHHHHHHHTTEEEECCTTCCSSCCBCSSSSCCBSSCCEEEEEET
T ss_pred             CCCCCCccChhHHHHHHHHHHHHHHHHHhCEEEeCCCCCCCceeccceEEeeCCCEEEEEEEC
Confidence            999999999999999999999999999999999876643  2223456788999999999998



>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure