Citrus Sinensis ID: 040780

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-----

MREEEIEKLRGVVRDCVSKHLYSSAIFFADKVAALTNDPADVYMQAQALFLGRHYRRAFHLLNASKIVLRDLRFRYLAAKCLEELKEWEQCLSML

ccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHccccccccHHHHHHHHHHHHHHccHHHHHccc

****EIEKLRGVVRDCVSKHLYSSAIFFADKVAALTNDPADVYMQAQALFLGRHYRRAFHLLNASKIVLRDLRFRYLAAKCLEELKEWEQCLSML

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MREEEIEKLRGVVRDCVSKHLYSSAIFFADKVAALTNDPADVYMQAQALFLGRHYRRAFHLLNASKIVLRDLRFRYLAAKCLEELKEWEQCLSML

Annotation	Function Description	Confidence Level	Reference Protein
Anaphase-promoting complex subunit 6	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex controls several key steps in the cell cycle by mediating ubiquitination and subsequent degradation of target proteins such as cyclins. The APC/C complex is required for the female gametophyte development and is involved in several aspect of development by controlling cell division and cell elongation. Involved in the control of endoreduplication.	probable	B3DNN5

No EC number assigned to the protein, probably not an enzyme!

Template: 2XPI, chain A
Confidence level:very confident
Coverage over the Query: 5-94
View the alignment between query and template
View the model in PyMOL