Citrus Sinensis ID: 040780
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 95 | ||||||
| 297839749 | 543 | cell division cycle family protein [Arab | 1.0 | 0.174 | 0.957 | 6e-47 | |
| 3834317 | 521 | Similar to CDC16 protein gb|U18291 (CDC1 | 1.0 | 0.182 | 0.947 | 1e-46 | |
| 18412102 | 543 | anaphase-promoting complex subunit 6 [Ar | 1.0 | 0.174 | 0.947 | 1e-46 | |
| 22324595 | 542 | anaphase promoting complex/cyclosome sub | 1.0 | 0.175 | 0.947 | 1e-46 | |
| 224116978 | 542 | predicted protein [Populus trichocarpa] | 1.0 | 0.175 | 0.936 | 6e-46 | |
| 255565311 | 655 | cell division cycle, putative [Ricinus c | 1.0 | 0.145 | 0.936 | 9e-46 | |
| 356545461 | 547 | PREDICTED: anaphase-promoting complex su | 1.0 | 0.173 | 0.936 | 1e-45 | |
| 356517052 | 545 | PREDICTED: anaphase-promoting complex su | 1.0 | 0.174 | 0.936 | 1e-45 | |
| 255578574 | 469 | cell division cycle, putative [Ricinus c | 1.0 | 0.202 | 0.926 | 2e-45 | |
| 225461701 | 545 | PREDICTED: anaphase-promoting complex su | 1.0 | 0.174 | 0.915 | 2e-44 |
| >gi|297839749|ref|XP_002887756.1| cell division cycle family protein [Arabidopsis lyrata subsp. lyrata] gi|297333597|gb|EFH64015.1| cell division cycle family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Score = 191 bits (484), Expect = 6e-47, Method: Compositional matrix adjust.
Identities = 91/95 (95%), Positives = 94/95 (98%)
Query: 1 MREEEIEKLRGVVRDCVSKHLYSSAIFFADKVAALTNDPADVYMQAQALFLGRHYRRAFH 60
MREEEIEK+RGVVRDCVSKHLYSSAIFFADKVAALTNDPAD+YMQAQALFLGRHYRRAFH
Sbjct: 1 MREEEIEKIRGVVRDCVSKHLYSSAIFFADKVAALTNDPADIYMQAQALFLGRHYRRAFH 60
Query: 61 LLNASKIVLRDLRFRYLAAKCLEELKEWEQCLSML 95
LLNASKIVLRDLRFRYLAAKCLEELKEW+QCL ML
Sbjct: 61 LLNASKIVLRDLRFRYLAAKCLEELKEWDQCLLML 95
|
Source: Arabidopsis lyrata subsp. lyrata Species: Arabidopsis lyrata Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|3834317|gb|AAC83033.1| Similar to CDC16 protein gb|U18291 (CDC16Hs) from Homo sapiens [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18412102|ref|NP_565188.1| anaphase-promoting complex subunit 6 [Arabidopsis thaliana] gi|302595634|sp|B3DNN5.1|CDC16_ARATH RecName: Full=Anaphase-promoting complex subunit 6; AltName: Full=Cell division cycle protein 16 homolog; Short=CDC16 homolog; AltName: Full=Cyclosome subunit 6; AltName: Full=Protein NOMEGA gi|190016006|gb|ACE62891.1| At1g78770 [Arabidopsis thaliana] gi|332198027|gb|AEE36148.1| anaphase-promoting complex subunit 6 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22324595|gb|AAM95623.1| anaphase promoting complex/cyclosome subunit [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224116978|ref|XP_002331799.1| predicted protein [Populus trichocarpa] gi|222874495|gb|EEF11626.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255565311|ref|XP_002523647.1| cell division cycle, putative [Ricinus communis] gi|223537099|gb|EEF38733.1| cell division cycle, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356545461|ref|XP_003541161.1| PREDICTED: anaphase-promoting complex subunit 6-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356517052|ref|XP_003527204.1| PREDICTED: anaphase-promoting complex subunit 6-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255578574|ref|XP_002530149.1| cell division cycle, putative [Ricinus communis] gi|223530348|gb|EEF32241.1| cell division cycle, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225461701|ref|XP_002283201.1| PREDICTED: anaphase-promoting complex subunit 6 [Vitis vinifera] gi|302142883|emb|CBI20178.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 95 | ||||||
| TAIR|locus:2037523 | 543 | APC6 "anaphase promoting compl | 1.0 | 0.174 | 0.947 | 7.1e-45 | |
| UNIPROTKB|E1BPM5 | 620 | CDC16 "Uncharacterized protein | 0.947 | 0.145 | 0.439 | 3.1e-12 | |
| RGD|1305076 | 620 | Cdc16 "cell division cycle 16" | 0.947 | 0.145 | 0.439 | 4e-12 | |
| UNIPROTKB|F1P4A5 | 623 | CDC16 "Uncharacterized protein | 0.947 | 0.144 | 0.428 | 5.1e-12 | |
| ZFIN|ZDB-GENE-051113-132 | 616 | cdc16 "cell division cycle 16 | 0.947 | 0.146 | 0.406 | 6.4e-12 | |
| UNIPROTKB|E2R5H6 | 620 | CDC16 "Uncharacterized protein | 0.947 | 0.145 | 0.428 | 6.5e-12 | |
| UNIPROTKB|Q13042 | 620 | CDC16 "Cell division cycle pro | 0.947 | 0.145 | 0.428 | 8.3e-12 | |
| MGI|MGI:1917207 | 620 | Cdc16 "CDC16 cell division cyc | 0.947 | 0.145 | 0.439 | 1.1e-11 | |
| UNIPROTKB|I3L944 | 620 | CDC16 "Uncharacterized protein | 0.778 | 0.119 | 0.453 | 1.2e-09 | |
| UNIPROTKB|G4N150 | 664 | MGG_07440 "Anaphase-promoting | 0.915 | 0.131 | 0.390 | 3.5e-09 |
| TAIR|locus:2037523 APC6 "anaphase promoting complex 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 472 (171.2 bits), Expect = 7.1e-45, P = 7.1e-45
Identities = 90/95 (94%), Positives = 94/95 (98%)
Query: 1 MREEEIEKLRGVVRDCVSKHLYSSAIFFADKVAALTNDPADVYMQAQALFLGRHYRRAFH 60
MREEEIEK+RGVVRDCVSKHLYSSAIFFADKVAALTNDP+D+YMQAQALFLGRHYRRAFH
Sbjct: 1 MREEEIEKIRGVVRDCVSKHLYSSAIFFADKVAALTNDPSDIYMQAQALFLGRHYRRAFH 60
Query: 61 LLNASKIVLRDLRFRYLAAKCLEELKEWEQCLSML 95
LLNASKIVLRDLRFRYLAAKCLEELKEW+QCL ML
Sbjct: 61 LLNASKIVLRDLRFRYLAAKCLEELKEWDQCLLML 95
|
|
| UNIPROTKB|E1BPM5 CDC16 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1305076 Cdc16 "cell division cycle 16" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P4A5 CDC16 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-051113-132 cdc16 "cell division cycle 16 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R5H6 CDC16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13042 CDC16 "Cell division cycle protein 16 homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1917207 Cdc16 "CDC16 cell division cycle 16" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L944 CDC16 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4N150 MGG_07440 "Anaphase-promoting complex subunit cut9" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh2_kg.2__2169__AT1G78770.1 | annotation not avaliable (543 aa) | ||||||||||
(Arabidopsis lyrata) | |||||||||||
| scaffold_304179.1 | • | • | • | 0.916 | |||||||
| scaffold_500481.1 | • | • | • | • | 0.866 | ||||||
| fgenesh2_kg.3__2801__AT2G04660.1 | • | • | • | 0.813 | |||||||
| fgenesh2_kg.4__1988__AT2G39090.1 | • | • | • | 0.737 | |||||||
| fgenesh2_kg.3__3171__AT2G20000.1 | • | • | • | • | 0.695 | ||||||
| scaffold_100656.1 | • | • | • | 0.689 | |||||||
| fgenesh2_kg.5__1167__AT3G48150.1 | • | • | • | • | • | 0.684 | |||||
| fgenesh2_kg.7__60__AT4G38630.1 | • | • | 0.641 | ||||||||
| fgenesh2_kg.3__1785__AT3G16320.1 | • | • | • | • | 0.572 | ||||||
| fgenesh2_kg.7__1789__AT4G24820.1 | • | • | 0.553 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 95 | |||
| pfam12895 | 80 | pfam12895, Apc3, Anaphase-promoting complex, cyclo | 1e-17 |
| >gnl|CDD|221837 pfam12895, Apc3, Anaphase-promoting complex, cyclosome, subunit 3 | Back alignment and domain information |
|---|
Score = 70.0 bits (172), Expect = 1e-17
Identities = 29/77 (37%), Positives = 46/77 (59%), Gaps = 1/77 (1%)
Query: 19 KHLYSSAIFFADKVAALTNDPADVYMQAQALFLGRHYRRAFHLLNASKIVLRDLRFRYLA 78
+ Y +AIF A+K+ ALT D Y+ AQ FL Y+RA+ LL K+ RYL
Sbjct: 2 QGNYENAIFLAEKLLALTPSNEDAYLLAQCYFLQGQYKRAYELLRKLKLDNS-SGCRYLL 60
Query: 79 AKCLEELKEWEQCLSML 95
A+CL +L ++++ +++L
Sbjct: 61 AQCLLKLGKYDEAIAVL 77
|
Apc3, otherwise known as Cdc27, is one of the subunits of the anaphase-promoting complex or cyclosome. The anaphase-promoting complex is a multiprotein subunit E3 ubiquitin ligase complex that controls segregation of chromosomes and exit from mitosis in eukaryotes. The protein members of this family contain TPR repeats just as those of Apc7 do, and it appears that these TPR units bind the C-termini of the APC co-activators CDH1 and CDC20. Length = 80 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 95 | |||
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.84 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 99.74 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 98.6 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 98.22 | |
| PF04049 | 142 | APC8: Anaphase promoting complex subunit 8 / Cdc23 | 98.21 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.2 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.08 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.06 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 98.04 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 97.97 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 97.95 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 97.92 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 97.8 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 97.7 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 97.65 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 97.65 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 97.6 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 97.58 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 97.58 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 97.58 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 97.5 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 97.49 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 97.46 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 97.44 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 97.41 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 97.38 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 97.36 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 97.34 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 97.32 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 97.29 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 97.28 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 97.27 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 97.25 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 97.24 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 97.22 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 97.22 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 97.2 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 97.19 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 97.18 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 97.17 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 97.12 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 97.09 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 97.08 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 97.06 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 97.06 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 97.04 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 97.01 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 96.93 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 96.84 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 96.75 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 96.74 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 96.73 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 96.69 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 96.68 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 96.68 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 96.66 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 96.63 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 96.59 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 96.55 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 96.55 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 96.43 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 96.42 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 96.42 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 96.38 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 96.36 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 96.28 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 96.16 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 96.09 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 95.97 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 95.87 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 95.82 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 95.64 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 95.57 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 95.5 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 95.44 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 95.42 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 95.36 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 95.22 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 95.19 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 95.13 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 95.13 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 95.07 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 95.0 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 94.97 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 94.9 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 94.85 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 94.8 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 94.75 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 94.74 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 94.66 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 94.48 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 94.47 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 94.45 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 94.43 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 94.27 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 94.15 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 94.1 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 93.81 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 93.77 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 93.45 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 93.44 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 93.39 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 93.03 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 92.97 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 92.78 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 92.66 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 92.64 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 92.57 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 92.01 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 91.71 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 90.87 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 90.81 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 90.66 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 90.65 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 90.57 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 90.52 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 90.22 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 90.15 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 90.06 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 90.06 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 89.91 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 89.87 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 89.84 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 89.78 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 89.59 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 89.4 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 88.82 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 88.8 | |
| PF10255 | 404 | Paf67: RNA polymerase I-associated factor PAF67; I | 88.51 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 88.19 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 88.14 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 88.1 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 88.04 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 87.98 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 87.98 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 87.76 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 87.73 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 87.66 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 87.63 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 87.51 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 86.77 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 86.72 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 86.61 | |
| PF14863 | 141 | Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB | 86.47 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 86.17 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 85.75 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 85.16 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 85.16 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 84.9 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 84.32 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 84.21 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 84.09 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 84.02 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 83.88 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 83.6 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 83.44 | |
| PF09477 | 116 | Type_III_YscG: Bacterial type II secretion system | 83.26 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 83.09 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 83.01 | |
| TIGR02508 | 115 | type_III_yscG type III secretion protein, YscG fam | 82.38 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 82.32 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 82.04 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 81.46 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 81.43 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 81.21 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 80.86 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 80.69 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 80.38 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 80.26 |
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.84 E-value=6.5e-21 Score=150.25 Aligned_cols=90 Identities=58% Similarity=0.963 Sum_probs=86.7
Q ss_pred HHHHHHHHHHHHHhCChhhHHHHHHHHhhhcCCchhHHHHHHHHhhCCCHHHHHHHHhcCcccccChhhHHHHHHHHHHc
Q 040780 6 IEKLRGVVRDCVSKHLYSSAIFFADKVAALTNDPADVYMQAQALFLGRHYRRAFHLLNASKIVLRDLRFRYLAAKCLEEL 85 (95)
Q Consensus 6 ~~~Lr~~v~~~l~~~~y~~AiF~Aekl~a~~~~~~~~~llA~~l~~~~~~~~A~~ll~~~~l~~~~~~c~yL~A~c~~~l 85 (95)
+++.|++|++++++++|++|+|||||+..++++|.|+||+|||||..|+|+||.++++.+++...++.|+||+++|++++
T Consensus 16 ~~~~~~~~r~~l~q~~y~~a~f~adkV~~l~~dp~d~~~~aq~l~~~~~y~ra~~lit~~~le~~d~~cryL~~~~l~~l 95 (611)
T KOG1173|consen 16 LEKYRRLVRDALMQHRYKTALFWADKVAGLTNDPADIYWLAQVLYLGRQYERAAHLITTYKLEKRDIACRYLAAKCLVKL 95 (611)
T ss_pred HHHHHHHHHHHHHHHhhhHHHHHHHHHHhccCChHHHHHHHHHHHhhhHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHH
Confidence 67788888899999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccHHHHHhcC
Q 040780 86 KEWEQCLSML 95 (95)
Q Consensus 86 ~~~~eal~~L 95 (95)
++|++|+.+|
T Consensus 96 k~~~~al~vl 105 (611)
T KOG1173|consen 96 KEWDQALLVL 105 (611)
T ss_pred HHHHHHHHHh
Confidence 9999999875
|
|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PF04049 APC8: Anaphase promoting complex subunit 8 / Cdc23 ; InterPro: IPR007192 The anaphase-promoting complex is composed of eight protein subunits, including BimE (APC1), CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8) | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF09477 Type_III_YscG: Bacterial type II secretion system chaperone protein (type_III_yscG); InterPro: IPR013348 YscG is a molecular chaperone for YscE, where both are part of the type III secretion system that in Yersinia is designated Ysc (Yersinia secretion) | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02508 type_III_yscG type III secretion protein, YscG family | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 95 | ||||
| 2xpi_A | 597 | Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1 | 5e-06 |
| >pdb|2XPI|A Chain A, Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1 Length = 597 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 95 | |||
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 8e-26 |
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
Score = 98.4 bits (245), Expect = 8e-26
Identities = 29/93 (31%), Positives = 42/93 (45%)
Query: 2 REEEIEKLRGVVRDCVSKHLYSSAIFFADKVAALTNDPADVYMQAQALFLGRHYRRAFHL 61
+ LR D + + Y A F +KV +T +P D + AQ Y RA L
Sbjct: 80 SLSREDYLRLWRHDALMQQQYKCAAFVGEKVLDITGNPNDAFWLAQVYCCTGDYARAKCL 139
Query: 62 LNASKIVLRDLRFRYLAAKCLEELKEWEQCLSM 94
L + R RYLAA CL +L +W+ L++
Sbjct: 140 LTKEDLYNRSSACRYLAAFCLVKLYDWQGALNL 172
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 95 | |||
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 99.45 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 98.72 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 98.71 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 98.71 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 98.7 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 98.67 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 98.65 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 98.63 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 98.62 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 98.61 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 98.59 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 98.58 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 98.56 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 98.53 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 98.51 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 98.5 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 98.48 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 98.45 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 98.41 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 98.39 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 98.38 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 98.38 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 98.35 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 98.35 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 98.32 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.3 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 98.27 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 98.27 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 98.27 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.27 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 98.26 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 98.24 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 98.22 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 98.21 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.21 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.16 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 98.15 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 98.15 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 98.14 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.14 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 98.13 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 98.12 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 98.12 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 98.11 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 98.1 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 98.1 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 98.09 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 98.09 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 98.09 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 98.06 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 98.05 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 98.04 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 98.04 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 98.04 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.02 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 98.02 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 98.01 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 98.0 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.99 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 97.99 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.99 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.98 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.97 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 97.97 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 97.97 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.96 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 97.95 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 97.95 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 97.92 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 97.92 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 97.9 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 97.89 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 97.89 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 97.88 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 97.88 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.87 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.85 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 97.84 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 97.83 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 97.83 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 97.82 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 97.82 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.81 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 97.77 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 97.76 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 97.75 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 97.73 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 97.73 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 97.71 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 97.69 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.68 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 97.65 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 97.65 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 97.64 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 97.62 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 97.62 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 97.61 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 97.57 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 97.57 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.57 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.55 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 97.55 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 97.54 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.54 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 97.54 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.54 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 97.53 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 97.52 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 97.52 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 97.51 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 97.51 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.5 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 97.48 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 97.47 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 97.47 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 97.45 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 97.41 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 97.41 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 97.38 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 97.37 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 97.34 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 97.34 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 97.32 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 97.29 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 97.28 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 97.28 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 97.27 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 97.23 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 97.22 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 97.2 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 97.19 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 97.17 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 97.17 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 97.16 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 97.16 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 97.13 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 97.08 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 97.03 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 97.02 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 97.0 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 97.0 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 97.0 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 96.95 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 96.94 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 96.93 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 96.91 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 96.88 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 96.88 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 96.86 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.86 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 96.85 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 96.83 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 96.79 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 96.78 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 96.78 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 96.76 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 96.69 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 96.69 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 96.69 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 96.66 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 96.58 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 96.53 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 96.49 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 96.44 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 96.44 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 96.24 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 96.18 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 96.13 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 96.01 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 95.99 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 95.8 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 95.75 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 95.74 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 95.71 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 95.64 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 95.61 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 95.6 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 95.54 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 95.52 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 95.5 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 95.49 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 95.44 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 95.4 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 95.23 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 95.03 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 94.65 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 94.54 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 94.37 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 94.32 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 94.18 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 94.06 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 93.79 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 93.41 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 93.34 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 93.29 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 93.04 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 92.83 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 92.55 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 91.66 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 91.59 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 91.25 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 91.21 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 90.93 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 90.42 | |
| 2uwj_G | 115 | Type III export protein PSCG; virulence, chaperone | 90.24 | |
| 2p58_C | 116 | Putative type III secretion protein YSCG; type III | 89.9 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 89.65 | |
| 4gq2_M | 950 | Nucleoporin NUP120; beta propeller alpha helical, | 89.13 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 88.98 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 87.83 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 87.79 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 87.66 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 85.79 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 85.1 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 84.35 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 83.5 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 83.13 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 82.59 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 80.8 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 80.5 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 80.17 |
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.45 E-value=1.7e-13 Score=93.98 Aligned_cols=88 Identities=24% Similarity=0.412 Sum_probs=72.9
Q ss_pred HHHHHHHHHHHhCChhhHHHHHHHHhhhcC-Cch---------hHHHHHHHHhhCCCHHHHHHHHhc----CcccccC--
Q 040780 8 KLRGVVRDCVSKHLYSSAIFFADKVAALTN-DPA---------DVYMQAQALFLGRHYRRAFHLLNA----SKIVLRD-- 71 (95)
Q Consensus 8 ~Lr~~v~~~l~~~~y~~AiF~Aekl~a~~~-~~~---------~~~llA~~l~~~~~~~~A~~ll~~----~~l~~~~-- 71 (95)
-|++.|+..++.++|++|++.+++++++++ +++ .++++|+++|..|+|.||....++ .+...+.
T Consensus 22 ~l~dqik~L~d~~LY~sA~~La~lLlSl~~~~~~~~sp~~~~~~l~~ladalf~~~eyrrA~~~y~qALq~~k~l~k~~s 101 (167)
T 3ffl_A 22 NVIDHVRDMAAAGLHSNVRLLSSLLLTLSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSK 101 (167)
T ss_dssp CHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSTTSSCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHCC-----
T ss_pred HHHHHHHHHHHhhhHHHHHHHHHHHHHhhcCCcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHhcCCC
Confidence 478899999999999999999999999995 333 569999999999999999988875 2221111
Q ss_pred --------------------hhhHHHHHHHHHHcccHHHHHhcC
Q 040780 72 --------------------LRFRYLAAKCLEELKEWEQCLSML 95 (95)
Q Consensus 72 --------------------~~c~yL~A~c~~~l~~~~eal~~L 95 (95)
..++|..|+|+.+++++++|+.+|
T Consensus 102 ~~~~~~~~ss~p~s~~~~~e~Elkykia~C~~~l~~~~~Ai~~L 145 (167)
T 3ffl_A 102 VRPSTGNSASTPQSQCLPSEIEVKYKLAECYTVLKQDKDAIAIL 145 (167)
T ss_dssp ---------------CCCCHHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred ccccccccCCCcccccccchHHHHHHHHHHHHHHCCHHHHHHHH
Confidence 158999999999999999999764
|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 95 | |||
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.82 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.72 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 98.63 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.63 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 98.32 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 98.3 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.26 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 98.22 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.11 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 98.05 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 98.05 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 97.98 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 97.95 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 97.88 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.88 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.79 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 97.74 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 97.72 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 97.64 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 97.64 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 97.57 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 97.5 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 97.22 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 97.21 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 97.15 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 97.12 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 97.08 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 96.92 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 96.92 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.83 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 96.75 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 96.75 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.71 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 96.66 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 96.65 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 96.39 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 96.29 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 96.24 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 96.09 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 95.98 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 94.82 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 94.51 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 94.34 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 92.66 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 92.63 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 92.05 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 89.34 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 89.18 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 88.83 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 83.21 |
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: Hop species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.82 E-value=1.6e-08 Score=62.03 Aligned_cols=90 Identities=13% Similarity=0.042 Sum_probs=79.1
Q ss_pred HHHHHHHHHHHHHHhCChhhHHHHHHHHhhhcC-CchhHHHHHHHHhhCCCHHHHHHHHhcC-cccccChhhHHHHHHHH
Q 040780 5 EIEKLRGVVRDCVSKHLYSSAIFFADKVAALTN-DPADVYMQAQALFLGRHYRRAFHLLNAS-KIVLRDLRFRYLAAKCL 82 (95)
Q Consensus 5 ~~~~Lr~~v~~~l~~~~y~~AiF~Aekl~a~~~-~~~~~~llA~~l~~~~~~~~A~~ll~~~-~l~~~~~~c~yL~A~c~ 82 (95)
.++.|+..-..++..+.|+.|+..-++++..+| ++...+.+|.|++..|++..|+...++. .+.+.++...+-.|.|+
T Consensus 2 ~~~~l~~~g~~~~~~g~~~eAi~~~~~al~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~g~~~ 81 (117)
T d1elwa_ 2 QVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAAL 81 (117)
T ss_dssp HHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCcchhhhhcccccccccccccccchhhhhHHHhccchhhHHHHHHHHH
Confidence 467788889999999999999999999999998 6667788899999999999999987654 34467888899999999
Q ss_pred HHcccHHHHHhc
Q 040780 83 EELKEWEQCLSM 94 (95)
Q Consensus 83 ~~l~~~~eal~~ 94 (95)
..+|+|++|+..
T Consensus 82 ~~~~~~~~A~~~ 93 (117)
T d1elwa_ 82 EFLNRFEEAKRT 93 (117)
T ss_dssp HHTTCHHHHHHH
T ss_pred HHccCHHHHHHH
Confidence 999999999864
|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|