Citrus Sinensis ID: 040810

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480
MEGKARNHLLLLFSFFFTAAASLQYQTFVLNSLPTPSTLSWPESVSVSESESSLPLPAPDAESSLSLRLHHVDSLSFNRTPEHLFNLRIQRDVLRVKSLTAFAESAVRVPPRNRSRGRANGGFSSSVISGLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCKKCYSQTDPVFDPAKSRSFATVPCRSPLCRKLDSSGCNRRNTCLYQVSYGDGSITVGDFSTETLTFRGTRVARVALGCGHDNEGLFVAAAGLLGLGRGRLSFPTQTGRRFNRKFSYCLVDRSTSAKPSSMVFGDSAVSRTARFTPLLANPKLDTFYYVELVGISVGGAHVRGITASLFKLDPAGNGGVIIDSGTSVTRLTRPAYIALRDAFRAGASSLKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPATNYLIPVDSSGTFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAASRIGFAPRGCA
ccHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEEEcccccCEEEEEEccccCEEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccCEEEEEEEEEEEEcccccccEEEEEEEccccccccccEEECccccccccHHcccccccccEEEEEccccccccccEEEEcccccccccCECccccccccccEEEEEEEEEEEccEEEcccccccccccccccccEEEEcccccECccHHHHHHHHHHHHHHHccccccccccccccccccccccCCcccEEEEEECccEEECccccEEEEEccccEEEEEEEEcccccEEEEEEEEEcEEEEEEccccCEEECccccc
****ARNHLLLLFSFFFTAAASLQYQTFVLNSLPTPS********************************HHVDSLSFNRTPEHLFNLRIQRDVLRVKSLTAFAE***********************ISGLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCKKCYSQTDPVFDPAKSRSFATVPCRSPLCRKLDSSGCNRRNTCLYQVSYGDGSITVGDFSTETLTFRGTRVARVALGCGHDNEGLFVAAAGLLGLGRGRLSFPTQTGRRFNRKFSYCLVDR*****P**MVFGDSAVSRTARFTPLLANPKLDTFYYVELVGISVGGAHVRGITASLFKLDPAGNGGVIIDSGTSVTRLTRPAYIALRDAFRAGASSLKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPATNYLIPVDSSGTFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAASRIGFAPRGCA
xxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGKARNHLLLLFSFFFTAAASLQYQTFVLNSLPTPSTLSWPESVSVSESESSLPLPAPDAESSLSLRLHHVDSLSFNRTPEHLFNLRIQRDVLRVKSLTAFAESAVRVPPRNRSRGRANGGFSSSVISGLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCKKCYSQTDPVFDPAKSRSFATVPCRSPLCRKLDSSGCNRRNTCLYQVSYGDGSITVGDFSTETLTFRGTRVARVALGCGHDNEGLFVAAAGLLGLGRGRLSFPTQTGRRFNRKFSYCLVDRSTSAKPSSMVFGDSAVSRTARFTPLLANPKLDTFYYVELVGISVGGAHVRGITASLFKLDPAGNGGVIIDSGTSVTRLTRPAYIALRDAFRAGASSLKRAPDFSLFDTCFDLSGKTEVKVPTVVLHFRGADVSLPATNYLIPVDSSGTFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAASRIGFAPRGCA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.23.-Aspartic endopeptidases.probable
3.4.23.12Nepenthesin.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QDM, chain A
Confidence level:very confident
Coverage over the Query: 123-191,211-478
View the alignment between query and template
View the model in PyMOL
Template: 3VLA, chain A
Confidence level:very confident
Coverage over the Query: 120-169,183-477
View the alignment between query and template
View the model in PyMOL
Template: 1QZV, chain F
Confidence level:probable
Coverage over the Query: 57-68
View the alignment between query and template
View the model in PyMOL