Citrus Sinensis ID: 040816


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
AVMLESQTIKHMVEDGCADSVIPLLNVRGTILSMVIEYLKKHVEAKTTEDDLKNWDVDFAKLGQDTLFDLLMAANYLDIKSLLDLLCQTVADMIKGKSPEEIRQTFHIQNDFTPEEEEEIRTETPRAF
cHHHHHHHHHHHHHcccccccCCcccccHHHHHHHHHHHHHHcccccccccccccHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHccccccccHHHHHHHHHHccccc
A*MLESQTIKHMVEDGCADSVIPLLNVRGTILSMVIEYLKKHVEAKTTEDDLKNWDVDFAKLGQDTLFDLLMAANYLDIKSLLDLLCQTVADMIKGKSPEEIRQTFHIQNDFTPEEEEEIRTETPRAF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AVMLESQTIKHMVEDGCADSVIPLLNVRGTILSMVIEYLKKHVEAKTTEDDLKNWDVDFAKLGQDTLFDLLMAANYLDIKSLLDLLCQTVADMIKGKSPEEIRQTFHIQNDFTPEEEEEIRTETPRAF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SKP1-like protein 11 Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends of the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1 (By similarity). Plays a role during early flowers reproductive development.probableO49484
SKP1-like protein 12 Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends of the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1 (By similarity). Plays a role during early flowers reproductive development.probableO65674
SCF ubiquitin ligase complex protein SKP1b probableQ557E4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P1M, chain A
Confidence level:very confident
Coverage over the Query: 1-10,23-38,70-128
View the alignment between query and template
View the model in PyMOL