Citrus Sinensis ID: 040841

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280
MGRAPCCSKVGLQRGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNYLRPDIKRGNITPDEDDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKRLRVQGTDPNTHKKLSEPSLVQDGIIKKRRRISKTEAEAAAAAASPVEPTGKHKLHLPKPIRVTTTYLLPRNESFARTTFSQGGEGVLAAHVLEEVPSYSLKDGDDGAAGFLVADHHLVNGSDFECQSQIFPGENSLEKLYEEYLQILKNDDEQLQLDCFAESLLK
ccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHccccccccccccccHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcc
cccccccHHcccccccccHHHHHHHHHHHHHcccccHcHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHccccHHHHcccccccccccccHHHcccccccccccccccHHHHHHccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHcc
mgrapccskvglqrgpwtpredTLLTEYIQVHGeghwrslpkkagllrcgkSCRLRWMNylrpdikrgnitpdeDDLIIRLHSLLGNRwsliagrlpgrtdneiKNYWNTHLSKrlrvqgtdpnthkklsepslvqdgiikkRRRISKTEAEAAAaaaspveptgkhklhlpkpirvtttyllprnesfarttfsqggegVLAAHvleevpsyslkdgddgaaGFLVADhhlvngsdfecqsqifpgensLEKLYEEYLQILKNDDEQLQLDCFAESLLK
mgrapccskvglqrgpwtpreDTLLTEYIQVHgeghwrslpkkagLLRCGKSCRLRWMNylrpdikrgnitpdEDDLIIRLHSLLGNRWsliagrlpgrtdNEIKNYWnthlskrlrvqgtdpnthkklsepslvqdgiikKRRRISKTEAEAaaaaaspveptgkhklhlpkpiRVTTTYLLPRNESFARTTFSQGGEGVLAAHVLEEVPSYSLKDGDDGAAGFLVADHHLVNGSDFECQSQIFPGENSLEKLYEEYLQILKNDDEQLQLDCFAESLLK
MGRAPCCSKVGLQRGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNYLRPDIKRGNITPDEDDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKRLRVQGTDPNTHKKLSEPSLVQDGIIKKRRRISKTeaeaaaaaaSPVEPTGKHKLHLPKPIRVTTTYLLPRNESFARTTFSQGGEGVLAAHVLEEVPSYSLKDGDDGAAGFLVADHHLVNGSDFECQSQIFPGENSLEKLYEEYLQILKNDDEQLQLDCFAESLLK
******CSKVGLQRGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNYLRPDIKRGNITPDEDDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKR*******************************************************LPKPIRVTTTYLLPRNESFARTTFSQGGEGVLAAHVLEEVPSYSLKDGDDGAAGFLVADHHLVNGSDFECQSQIFPGENSLEKLYEEYLQILKNDDEQLQLDCF******
*GRAPCCSKVGLQRGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNYLRPDIKRGNITPDEDDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKRLR********************************************************************************************************AAGFLVADHHLV****************SLEKLYEEYLQILKNDDEQLQLDCFAESLL*
MGRAPCCSKVGLQRGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNYLRPDIKRGNITPDEDDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKRLRVQGTDPNTHKKLSEPSLVQDGIIKKRRR*********************HKLHLPKPIRVTTTYLLPRNESFARTTFSQGGEGVLAAHVLEEVPSYSLKDGDDGAAGFLVADHHLVNGSDFECQSQIFPGENSLEKLYEEYLQILKNDDEQLQLDCFAESLLK
***APCCSKVGLQRGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNYLRPDIKRGNITPDEDDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKRLRVQGTDPNTHKKL********************************************************************************************AAGFLVADHHLV*G*DFECQSQIFPGENSLEKLYEEYLQILKNDDEQLQLDCFAESLLK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRAPCCSKVGLQRGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNYLRPDIKRGNITPDEDDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKRLRVQGTDPNTHKKLSEPSLVQDGIIKKRRRISKTEAEAAAAAASPVEPTGKHKLHLPKPIRVTTTYLLPRNESFARTTFSQGGEGVLAAHVLEEVPSYSLKDGDDGAAGFLVADHHLVNGSDFECQSQIFPGENSLEKLYEEYLQILKNDDEQLQLDCFAESLLK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query280 2.2.26 [Sep-21-2011]
Q38850249 Transcription repressor M yes no 0.528 0.594 0.631 3e-55
Q9S9K9257 Transcription factor MYB3 no no 0.503 0.548 0.655 7e-55
Q38851236 Transcription repressor M no no 0.5 0.593 0.664 2e-54
Q9SZP1282 Transcription repressor M no no 0.578 0.574 0.598 2e-54
P81393232 Myb-related protein 308 O N/A no 0.496 0.599 0.669 5e-54
P20025255 Myb-related protein Zm38 N/A no 0.482 0.529 0.681 2e-52
P20026267 Myb-related protein Hv1 O N/A no 0.464 0.486 0.7 4e-52
P81395274 Myb-related protein 330 O N/A no 0.464 0.474 0.692 7e-52
O49608274 Transcription factor MYB3 no no 0.489 0.5 0.671 8e-52
O22264 371 Transcription factor MYB1 no no 0.535 0.404 0.585 9e-52
>sp|Q38850|MYB5_ARATH Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1 Back     alignment and function desciption
 Score =  215 bits (548), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 116/160 (72%), Gaps = 12/160 (7%)

Query: 4   APCCSKVGLQRGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNYLRP 63
            PCC+K+G++RGPWT  ED +L  +I+  GEG WRSLPK+AGLLRCGKSCRLRWMNYLRP
Sbjct: 15  TPCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRP 74

Query: 64  DIKRGNITPDEDDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKRLRVQGTDP 123
            +KRG IT DE+DLI+RLH LLGNRWSLIAGR+PGRTDNEIKNYWNTHL K+L  QG DP
Sbjct: 75  SVKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDP 134

Query: 124 NTHKKLSEPSLVQDGIIKKRRRISKTEAEAAAAAASPVEP 163
            THK L                I K E E +     P+EP
Sbjct: 135 QTHKPLDA------------NNIHKPEEEVSGGQKYPLEP 162
Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1 or BHLH042/TT8.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description
>sp|P20025|MYB38_MAIZE Myb-related protein Zm38 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|P20026|MYB1_HORVU Myb-related protein Hv1 OS=Hordeum vulgare GN=MYB1 PE=2 SV=1 Back     alignment and function description
>sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 Back     alignment and function description
>sp|O49608|MYB32_ARATH Transcription factor MYB32 OS=Arabidopsis thaliana GN=MYB32 PE=2 SV=1 Back     alignment and function description
>sp|O22264|MYB12_ARATH Transcription factor MYB12 OS=Arabidopsis thaliana GN=MYB12 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
290579513287 TT2 like MYB transcriptoin factor [Theob 0.985 0.961 0.695 1e-105
224068010285 predicted protein [Populus trichocarpa] 0.964 0.947 0.638 3e-94
130369073286 MYBPA1 protein [Vitis vinifera] 0.971 0.951 0.636 4e-94
225470950286 PREDICTED: myb-related protein 308 [Viti 0.971 0.951 0.640 2e-93
224130580270 predicted protein [Populus trichocarpa] 0.935 0.970 0.646 2e-93
381392355286 putative MYB transcription factor [Vitis 0.971 0.951 0.636 4e-93
324022716287 R2R3-MYB transcription factor [Prunus av 0.939 0.916 0.596 3e-86
297745498254 unnamed protein product [Vitis vinifera] 0.871 0.960 0.604 4e-83
356520266290 PREDICTED: uncharacterized protein LOC10 0.989 0.955 0.549 6e-81
351722536293 MYB transcription factor MYB92 [Glycine 0.982 0.938 0.557 3e-80
>gi|290579513|gb|ADD51352.1| TT2 like MYB transcriptoin factor [Theobroma cacao] Back     alignment and taxonomy information
 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 201/289 (69%), Positives = 225/289 (77%), Gaps = 13/289 (4%)

Query: 1   MGRAPCCSKVGLQRGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNY 60
           MGRAPCCSKVGL RGPWTPREDTLL +YIQ HG+GHWRSLPKKAGLLRCGKSCRLRWMNY
Sbjct: 1   MGRAPCCSKVGLHRGPWTPREDTLLVKYIQAHGDGHWRSLPKKAGLLRCGKSCRLRWMNY 60

Query: 61  LRPDIKRGNITPDEDDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKRLRVQG 120
           LRPDIKRGNITPDEDDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKRL  QG
Sbjct: 61  LRPDIKRGNITPDEDDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKRLLSQG 120

Query: 121 TDPNTHKKLSEPSLVQDGIIKKRRRISKTEAEAAAAAASPVEPTGKHKLHLPKPIRVTTT 180
           TDPNTHKKLSEP + Q    K  R  S  +   +    + VEP  + K+HLPKP+RV T+
Sbjct: 121 TDPNTHKKLSEPPVQQVKKRKSSRGNSNKKQNNSKGKGAKVEPE-EPKVHLPKPVRV-TS 178

Query: 181 YLLPRNESFAR-TTF-----SQGGEGVLAAHVLEEVPSYSLKDGDDGAAGFLVA--DHHL 232
           + LPRN+SF +  TF     SQGGEG L   V++   S ++ D D+   GFL A  DH  
Sbjct: 179 FSLPRNDSFDQCNTFSTVSSSQGGEGGLGTEVVQGPWSDNVND-DENGTGFLAAYDDHGF 237

Query: 233 VNGSDFECQSQIFPG--ENSLEKLYEEYLQILKNDDEQLQLDCFAESLL 279
           VNGSDFECQS +     +NSLEKLYEEYLQ+LK +D+Q+QLD FAESLL
Sbjct: 238 VNGSDFECQSHVPASDDDNSLEKLYEEYLQLLKTNDDQVQLDSFAESLL 286

Source: Theobroma cacao

Species: Theobroma cacao

Genus: Theobroma

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224068010|ref|XP_002302644.1| predicted protein [Populus trichocarpa] gi|222844370|gb|EEE81917.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|130369073|emb|CAJ90831.1| MYBPA1 protein [Vitis vinifera] Back     alignment and taxonomy information
>gi|225470950|ref|XP_002266014.1| PREDICTED: myb-related protein 308 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224130580|ref|XP_002320876.1| predicted protein [Populus trichocarpa] gi|222861649|gb|EEE99191.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|381392355|gb|AFG28178.1| putative MYB transcription factor [Vitis bellula] Back     alignment and taxonomy information
>gi|324022716|gb|ADY15314.1| R2R3-MYB transcription factor [Prunus avium] Back     alignment and taxonomy information
>gi|297745498|emb|CBI40578.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356520266|ref|XP_003528784.1| PREDICTED: uncharacterized protein LOC100803345 [Glycine max] Back     alignment and taxonomy information
>gi|351722536|ref|NP_001238271.1| MYB transcription factor MYB92 [Glycine max] gi|110931690|gb|ABH02844.1| MYB transcription factor MYB92 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
TAIR|locus:2009452257 MYB3 "myb domain protein 3" [A 0.503 0.548 0.655 2.4e-53
TAIR|locus:2092820249 MYB5 "myb domain protein 5" [A 0.446 0.502 0.752 8e-53
TAIR|locus:2133677236 MYB6 "myb domain protein 6" [A 0.5 0.593 0.664 8e-53
TAIR|locus:2121259282 MYB4 "myb domain protein 4" [A 0.489 0.485 0.686 2.7e-52
TAIR|locus:2059883269 MYB7 "myb domain protein 7" [A 0.528 0.550 0.627 2.4e-51
TAIR|locus:2155944342 MYB111 "myb domain protein 111 0.689 0.564 0.522 1.3e-50
TAIR|locus:2131576274 MYB32 "myb domain protein 32" 0.489 0.5 0.671 1.7e-50
TAIR|locus:1005716764212 HOS10 "high response to osmoti 0.471 0.622 0.659 4.6e-50
TAIR|locus:2150891326 MYB16 "myb domain protein 16" 0.532 0.457 0.644 4.6e-50
TAIR|locus:2062040371 MYB12 "myb domain protein 12" 0.457 0.345 0.671 9.5e-50
TAIR|locus:2009452 MYB3 "myb domain protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 552 (199.4 bits), Expect = 2.4e-53, P = 2.4e-53
 Identities = 95/145 (65%), Positives = 119/145 (82%)

Query:     1 MGRAPCCSKVGLQRGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNY 60
             MGR+PCC K  + +G WT  ED LL +YI+ HGEG WRSLP+ AGL RCGKSCRLRWMNY
Sbjct:     1 MGRSPCCEKAHMNKGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNY 60

Query:    61 LRPDIKRGNITPDEDDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKRLRVQG 120
             LRPD+KRGN T +ED+LII+LHSLLGN+WSLIAGRLPGRTDNEIKNYWNTH+ ++L  +G
Sbjct:    61 LRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRG 120

Query:   121 TDPNTHKKLSE----PSLVQDGIIK 141
              DPN+H+ ++E    PS +Q+ +++
Sbjct:   121 IDPNSHRLINESVVSPSSLQNDVVE 145
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009611 "response to wounding" evidence=IEP
GO:0009800 "cinnamic acid biosynthetic process" evidence=TAS
GO:0009892 "negative regulation of metabolic process" evidence=TAS
GO:0009651 "response to salt stress" evidence=IEP;RCA
GO:0009737 "response to abscisic acid stimulus" evidence=IEP;RCA
GO:0009751 "response to salicylic acid stimulus" evidence=IEP;RCA
GO:0009723 "response to ethylene stimulus" evidence=RCA
GO:0009733 "response to auxin stimulus" evidence=RCA
GO:0009739 "response to gibberellin stimulus" evidence=RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2092820 MYB5 "myb domain protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133677 MYB6 "myb domain protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121259 MYB4 "myb domain protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059883 MYB7 "myb domain protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155944 MYB111 "myb domain protein 111" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131576 MYB32 "myb domain protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716764 HOS10 "high response to osmotic stress 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150891 MYB16 "myb domain protein 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062040 MYB12 "myb domain protein 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 3e-71
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 2e-62
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 4e-15
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-13
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 6e-13
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 3e-12
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 3e-11
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 6e-10
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 5e-09
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 3e-07
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 7e-07
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  219 bits (559), Expect = 3e-71
 Identities = 101/159 (63%), Positives = 116/159 (72%), Gaps = 12/159 (7%)

Query: 5   PCCSKVGLQRGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNYLRPD 64
           PCC+K+G++RGPWT  ED +L  +I+  GEG WRSLPK+AGLLRCGKSCRLRWMNYLRP 
Sbjct: 16  PCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPS 75

Query: 65  IKRGNITPDEDDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKRLRVQGTDPN 124
           +KRG IT DE+DLI+RLH LLGNRWSLIAGR+PGRTDNEIKNYWNTHL K+L  QG DP 
Sbjct: 76  VKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDPQ 135

Query: 125 THKKLSEPSLVQDGIIKKRRRISKTEAEAAAAAASPVEP 163
           THK L                I K E E +     P+EP
Sbjct: 136 THKPLDA------------NNIHKPEEEVSGGQKYPIEP 162

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 280
PLN03091 459 hypothetical protein; Provisional 100.0
PLN03212249 Transcription repressor MYB5; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.8
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.74
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.68
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.57
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.55
PLN03212249 Transcription repressor MYB5; Provisional 99.52
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.51
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.44
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.44
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.39
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.29
PLN03091 459 hypothetical protein; Provisional 99.27
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.19
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.12
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.07
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.01
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.99
COG5147512 REB1 Myb superfamily proteins, including transcrip 98.45
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.99
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.89
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.88
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.67
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.55
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.37
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.24
KOG1279506 consensus Chromatin remodeling factor subunit and 97.13
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.95
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 96.86
KOG1279506 consensus Chromatin remodeling factor subunit and 96.85
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.73
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.69
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.33
PRK13923170 putative spore coat protein regulator protein YlbO 96.27
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.27
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.25
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.95
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.14
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.05
PLN031421033 Probable chromatin-remodeling complex ATPase chain 94.93
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 94.45
PRK13923170 putative spore coat protein regulator protein YlbO 94.3
KOG2656445 consensus DNA methyltransferase 1-associated prote 93.09
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 92.94
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 92.59
KOG4282345 consensus Transcription factor GT-2 and related pr 90.01
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 88.73
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 86.68
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 84.81
KOG1194 534 consensus Predicted DNA-binding protein, contains 83.47
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 81.6
KOG4282345 consensus Transcription factor GT-2 and related pr 81.29
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.6e-39  Score=308.20  Aligned_cols=137  Identities=61%  Similarity=1.119  Sum_probs=130.4

Q ss_pred             CCCCCCCCCCCCCcCCCCHHHHHHHHHHHHHhCCCCccccccccCccccchhhhhhhhhccCCCCCCCCCCHHHHHHHHH
Q 040841            1 MGRAPCCSKVGLQRGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNYLRPDIKRGNITPDEDDLIIR   80 (280)
Q Consensus         1 mgr~~~~~k~~lkkg~WT~EED~~L~~lV~~~G~~~W~~IA~~~~~~Rt~~qCr~Rw~~~L~p~ikkg~WT~EED~~L~~   80 (280)
                      |||++||+|+.++||+||+|||++|+++|.+||.++|..||+.++.+|+++|||+||.++|+|.+++++||+|||++|++
T Consensus         1 mgr~~Cc~KqklrKg~WTpEEDe~L~~~V~kyG~~nWs~IAk~~g~gRT~KQCRERW~NyLdP~IkKgpWT~EED~lLLe   80 (459)
T PLN03091          1 MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLIIE   80 (459)
T ss_pred             CCCCccCcCCCCcCCCCCHHHHHHHHHHHHHhCcCCHHHHhhhhccCcCcchHhHHHHhccCCcccCCCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999998755999999999999999999999999999999999


Q ss_pred             HHHHhCCccccccccCCCCCHHHHHHHHHHhhhhHHhhCCCCccccccCCCCccccc
Q 040841           81 LHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKRLRVQGTDPNTHKKLSEPSLVQD  137 (280)
Q Consensus        81 lv~~~G~~W~~IA~~lpgRt~~qck~Rw~~~l~~~~~~~~~~~~e~~~l~~~~~~~~  137 (280)
                      ++++||++|..||+.|||||+++||+||+.+++++++..+..+.+++.+.+.....+
T Consensus        81 L~k~~GnKWskIAk~LPGRTDnqIKNRWnslLKKklr~~~I~p~t~kpl~e~E~~~d  137 (459)
T PLN03091         81 LHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPNTHKPLSEVENGED  137 (459)
T ss_pred             HHHHhCcchHHHHHhcCCCCHHHHHHHHHHHHHHHHHHcCCCCCCCCCccccccccc
Confidence            999999999999999999999999999999999999999999999998887654433

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 7e-22
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 2e-21
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 1e-20
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 1e-20
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 2e-20
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 4e-20
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 8e-12
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 3e-09
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 3e-09
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 7e-08
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 1e-04
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 2e-04
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 4e-04
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure 
Iteration: 1

 Score =  100 bits (250), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 68/105 (64%), Gaps = 1/105 (0%)
Query: 12  LQRGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNYLRPDIKRGNIT 71
           L +GPWT  ED  + E++Q +G   W  + K     R GK CR RW N+L P++K+ + T
Sbjct: 25  LNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWT 83
Query: 72  PDEDDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKRL 116
            +ED +I + H  LGNRW+ IA  LPGRTDN +KN+WN+ + +++
Sbjct: 84  EEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRRKV 128
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 8e-70
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 5e-66
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 4e-64
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 4e-57
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 6e-55
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 3e-52
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 3e-33
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 8e-05
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 6e-25
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 2e-04
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-21
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 3e-07
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 2e-18
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 2e-08
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 2e-13
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 2e-06
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 1e-08
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-08
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 1e-07
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-07
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 3e-06
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 3e-07
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 6e-07
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 3e-06
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 3e-06
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 6e-06
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 6e-06
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 8e-06
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 2e-05
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 2e-04
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 1e-04
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 2e-04
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
 Score =  211 bits (538), Expect = 8e-70
 Identities = 47/129 (36%), Positives = 69/129 (53%), Gaps = 1/129 (0%)

Query: 14  RGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNYLRPDIKRGNITPD 73
           +GP+T  ED L+ EY++ +G  +W  +       R  K CR RW N+L P + +   TP+
Sbjct: 2   KGPFTEAEDDLIREYVKENGPQNWPRITSFLPN-RSPKQCRERWFNHLDPAVVKHAWTPE 60

Query: 74  EDDLIIRLHSLLGNRWSLIAGRLPGRTDNEIKNYWNTHLSKRLRVQGTDPNTHKKLSEPS 133
           ED+ I R +  LG++WS+IA  +PGRTDN IKN WN+ +SKR+                 
Sbjct: 61  EDETIFRNYLKLGSKWSVIAKLIPGRTDNAIKNRWNSSISKRISTNSNHKEILLPDRSKK 120

Query: 134 LVQDGIIKK 142
                + KK
Sbjct: 121 RKAADVPKK 129
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.88
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.87
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.75
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.74
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.73
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.72
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.72
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.72
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.71
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.7
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.7
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.7
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.68
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.65
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.65
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.65
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.63
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.62
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.61
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.6
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.6
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.59
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.58
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.58
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.57
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.55
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.54
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.54
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.54
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.52
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.51
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.24
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.49
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.49
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.49
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.47
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.46
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.42
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.39
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.04
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.34
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.32
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.3
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.26
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.25
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.25
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.25
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.24
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.16
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.03
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.98
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.92
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.86
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.86
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.81
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.69
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.59
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.59
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.52
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.5
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.49
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.37
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.34
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.1
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.09
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.07
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.06
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.02
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.21
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.96
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.82
2crg_A70 Metastasis associated protein MTA3; transcription 97.55
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.55
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.54
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.48
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.28
2crg_A70 Metastasis associated protein MTA3; transcription 97.25
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.02
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.97
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.73
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.68
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.51
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.35
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 95.67
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 95.11
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 94.66
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 93.45
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 92.41
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 86.19
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
Probab=100.00  E-value=6.6e-35  Score=231.46  Aligned_cols=105  Identities=44%  Similarity=0.829  Sum_probs=99.7

Q ss_pred             CCCcCCCCHHHHHHHHHHHHHhCCCCccccccccCccccchhhhhhhhhccCCCCCCCCCCHHHHHHHHHHHHHhCCccc
Q 040841           11 GLQRGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNYLRPDIKRGNITPDEDDLIIRLHSLLGNRWS   90 (280)
Q Consensus        11 ~lkkg~WT~EED~~L~~lV~~~G~~~W~~IA~~~~~~Rt~~qCr~Rw~~~L~p~ikkg~WT~EED~~L~~lv~~~G~~W~   90 (280)
                      ++++|+||+|||++|+++|..||.++|..||..|++ |+++||++||.++|+|.+++++||+|||.+|+++|.+||++|.
T Consensus         1 ~l~k~~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~~-Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~~~~~G~~W~   79 (105)
T 1gv2_A            1 ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWA   79 (105)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHCTTCHHHHHTTSTT-CCHHHHHHHHHHTTCCCCCCCCCCHHHHHHHHHHHHHHSSCHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCcHHHHhhhhcC-CCHHHHHHHHHhccCCcccccCCCHHHHHHHHHHHHHhCCCHH
Confidence            478999999999999999999999899999999998 9999999999999999999999999999999999999999999


Q ss_pred             cccccCCCCCHHHHHHHHHHhhhhHH
Q 040841           91 LIAGRLPGRTDNEIKNYWNTHLSKRL  116 (280)
Q Consensus        91 ~IA~~lpgRt~~qck~Rw~~~l~~~~  116 (280)
                      .||+.|||||+++|++||+.++++++
T Consensus        80 ~Ia~~l~gRt~~~~k~rw~~~~~~~~  105 (105)
T 1gv2_A           80 EIAKLLPGRTDNAIKNHWNSTMRRKV  105 (105)
T ss_dssp             HHHTTCTTCCHHHHHHHHHHHTC---
T ss_pred             HHHHHcCCCCHHHHHHHHHHHHhccC
Confidence            99999999999999999999987753
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 280
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-18
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-11
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 7e-18
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 8e-10
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 1e-16
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 2e-14
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 2e-16
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 7e-15
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 3e-06
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 2e-14
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 8e-06
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 3e-14
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 3e-09
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-11
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 3e-11
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 5e-06
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 5e-11
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 6e-11
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 6e-11
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 7e-08
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 6e-10
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 1e-04
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 3e-09
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-06
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 1e-05
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 75.5 bits (186), Expect = 1e-18
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 12 LQRGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNYLRPD 64
          L +GPWT  ED  L + +Q +G   W  + K     R GK CR RW N+L P+
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.77
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.76
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.72
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.67
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.66
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.61
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.6
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.59
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.59
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.53
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.52
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.51
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.46
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.46
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.45
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.39
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.38
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.36
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.36
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.25
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.25
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.24
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.19
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.14
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.12
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.03
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.02
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.77
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.13
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.1
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.0
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.87
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.27
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.13
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.94
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.86
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.36
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 95.48
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 95.34
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 91.22
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 91.11
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 91.1
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 84.21
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.77  E-value=7.8e-20  Score=126.34  Aligned_cols=52  Identities=42%  Similarity=0.818  Sum_probs=50.0

Q ss_pred             CCcCCCCHHHHHHHHHHHHHhCCCCccccccccCccccchhhhhhhhhccCCC
Q 040841           12 LQRGPWTPREDTLLTEYIQVHGEGHWRSLPKKAGLLRCGKSCRLRWMNYLRPD   64 (280)
Q Consensus        12 lkkg~WT~EED~~L~~lV~~~G~~~W~~IA~~~~~~Rt~~qCr~Rw~~~L~p~   64 (280)
                      |+||+||+|||++|+++|++||.++|..||+.|++ ||+.||++||.++|+|.
T Consensus         1 l~rg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~~-Rt~~qc~~Rw~~~L~P~   52 (52)
T d1gvda_           1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPE   52 (52)
T ss_dssp             CCCCSCCHHHHHHHHHHHHHHCTTCHHHHHTTSTT-CCHHHHHHHHHHTTSCC
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCC-CCHHHHHHHHHhhCCCC
Confidence            68999999999999999999998899999999998 99999999999999984
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure