Citrus Sinensis ID: 040861

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
PIWAVIGPSSCDGGRIFSFEMHHRYSDQVKNWSISSGKLSHSDWPDKGSFDYYALLAHRDQILRGRHLSDTDTNSPLIFSDGNSTLRISSLGFLHYTTVQLGTPGMKFMVALDTGSDLFWVPCECSKCAPTQGSAYASDFELSIYNPEVSSTSKKVTCNNLLCAHRNRCPGTFSNCPYSVSYVSAQTSTSGILVEMFFT
ccEEEEcccccccccEEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEcccccEEEEEEEEcccccEEEEEEEccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEEEEEEEc
cEEEEEEcccccccccEEEEEEEEccHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccEEEcccccccccccccEEEEEEEEccccccEEEEEEEcccccEEEEccccccccccccccccccccccccccccccccccccccHHcccccccccccccccEEEEEEccccccccEEEEEccc
piwavigpsscdggrifsFEMHHRysdqvknwsissgklshsdwpdkgsfdYYALLAHRDQilrgrhlsdtdtnsplifsdgnstlriSSLGFLHYTTVQLGTPGMKFMVALDtgsdlfwvpcecskcaptqgsayasdfelsiynpevsstskkvtcnnllcahrnrcpgtfsncpysvSYVSAQTSTSGILVEMFFT
piwavigpsscdgGRIFSFEMHHRYSDQVKNWSISSGKLSHSDWPDKGSFDYYALLAHRDQILRGRHLSDTDTNSPLIFSDGNSTLRISSLGFLHYTTVQLGTPGMKFMVALDTGSDLFWVPCECSKCAPTQGSAYASDFELSIYNPEVSSTSKKVTCNNLLCAHRNRCPGTFSNCPYSVSYVsaqtstsgilvemfft
PIWAVIGPSSCDGGRIFSFEMHHRYSDQVKNWSISSGKLSHSDWPDKGSFDYYALLAHRDQILRGRHLSDTDTNSPLIFSDGNSTLRISSLGFLHYTTVQLGTPGMKFMVALDTGSDLFWVPCECSKCAPTQGSAYASDFELSIYNPEVSSTSKKVTCNNLLCAHRNRCPGTFSNCPYSVSYVSAQTSTSGILVEMFFT
*IWAVIGPSSCDGGRIFSFEMHHRYSDQVKNWSISSGKLSHSDWPDKGSFDYYALLAHRDQILRGRHLSDTDTNSPLIFSDGNSTLRISSLGFLHYTTVQLGTPGMKFMVALDTGSDLFWVPCECSKCAPTQGSAYASDFELSIYNPEVSSTSKKVTCNNLLCAHRNRCPGTFSNCPYSVSYVSAQTSTSGILVEMF**
PIWAV**PSSC**GRIFSFEMHHRYSD************************************************************ISSLGFLHYTTVQLGTPGMKFMVALDTGSDLFWVPCECSKCAPTQG*****DFELSIYNPEVSS****VTC*****************CPYSVSYVSAQTSTSGILVEMFFT
PIWAVIGPSSCDGGRIFSFEMHHRYSDQVKNWSISSGKLSHSDWPDKGSFDYYALLAHRDQILRGRHLSDTDTNSPLIFSDGNSTLRISSLGFLHYTTVQLGTPGMKFMVALDTGSDLFWVPCECSKCAPTQGSAYASDFELSIYNPEVSSTSKKVTCNNLLCAHRNRCPGTFSNCPYSVSYVSAQTSTSGILVEMFFT
PIWAVIGPSSCDGGRIFSFEMHHRYSDQVKNWSISSGKLSHSDWPDKGSFDYYALLAHRDQILRGRHLSDTDTNSPLIFSDGNSTLRISSLGFLHYTTVQLGTPGMKFMVALDTGSDLFWVPCECSKCAPTQGSAYASDFELSIYNPEV****KKVTCNNLLCAHRNRCPGTFSNCPYSVSYVSAQTSTSGILVEMFFT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PIWAVIGPSSCDGGRIFSFEMHHRYSDQVKNWSISSGKLSHSDWPDKGSFDYYALLAHRDQILRGRHLSDTDTNSPLIFSDGNSTLRISSLGFLHYTTVQLGTPGMKFMVALDTGSDLFWVPCECSKCAPTQGSAYASDFELSIYNPEVSSTSKKVTCNNLLCAHRNRCPGTFSNCPYSVSYVSAQTSTSGILVEMFFT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query199 2.2.26 [Sep-21-2011]
Q9LX20 528 Aspartic proteinase-like no no 0.884 0.333 0.415 8e-30
Q9S9K4 475 Aspartic proteinase-like no no 0.527 0.221 0.347 4e-11
Q9LS40 500 Protein ASPARTIC PROTEASE no no 0.396 0.158 0.337 1e-05
Q3EBM5 447 Probable aspartic proteas no no 0.653 0.290 0.279 3e-05
Q6XBF8 437 Aspartic proteinase CDR1 no no 0.457 0.208 0.313 6e-05
Q766C2 438 Aspartic proteinase nepen N/A no 0.462 0.210 0.292 0.0003
Q766C3 437 Aspartic proteinase nepen N/A no 0.678 0.308 0.244 0.0008
>sp|Q9LX20|ASPL1_ARATH Aspartic proteinase-like protein 1 OS=Arabidopsis thaliana GN=At5g10080 PE=1 SV=1 Back     alignment and function desciption
 Score =  130 bits (326), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 76/183 (41%), Positives = 112/183 (61%), Gaps = 7/183 (3%)

Query: 16  IFSFEMHHRYSDQVKNWSISSGKLSHSDWPDKGSFDYYALLAHRDQILRGRHLSDTDTNS 75
           +FS  + HR+SD+ +  SI +   S S  P+K S +YY LLA  D   R + ++      
Sbjct: 24  LFSSRLIHRFSDEGRA-SIKTPSSSDS-LPNKQSLEYYRLLAESD--FRRQRMNLGAKVQ 79

Query: 76  PLIFSDGNSTLRISS-LGFLHYTTVQLGTPGMKFMVALDTGSDLFWVPCECSKCAPTQGS 134
            L+ S+G+ T+   +  G+LHYT + +GTP + F+VALDTGS+L W+PC C +CAP   +
Sbjct: 80  SLVPSEGSKTISSGNDFGWLHYTWIDIGTPSVSFLVALDTGSNLLWIPCNCVQCAPLTST 139

Query: 135 AYAS--DFELSIYNPEVSSTSKKVTCNNLLCAHRNRCPGTFSNCPYSVSYVSAQTSTSGI 192
            Y+S    +L+ YNP  SSTSK   C++ LC   + C      CPY+V+Y+S  TS+SG+
Sbjct: 140 YYSSLATKDLNEYNPSSSSTSKVFLCSHKLCDSASDCESPKEQCPYTVNYLSGNTSSSGL 199

Query: 193 LVE 195
           LVE
Sbjct: 200 LVE 202

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 3EC: .EC: -
>sp|Q9S9K4|ASPL2_ARATH Aspartic proteinase-like protein 2 OS=Arabidopsis thaliana GN=At1g65240 PE=1 SV=2 Back     alignment and function description
>sp|Q9LS40|ASPG1_ARATH Protein ASPARTIC PROTEASE IN GUARD CELL 1 OS=Arabidopsis thaliana GN=ASPG1 PE=1 SV=1 Back     alignment and function description
>sp|Q3EBM5|ASPR1_ARATH Probable aspartic protease At2g35615 OS=Arabidopsis thaliana GN=At2g35615 PE=3 SV=1 Back     alignment and function description
>sp|Q6XBF8|CDR1_ARATH Aspartic proteinase CDR1 OS=Arabidopsis thaliana GN=CDR1 PE=1 SV=1 Back     alignment and function description
>sp|Q766C2|NEP2_NEPGR Aspartic proteinase nepenthesin-2 OS=Nepenthes gracilis GN=nep2 PE=1 SV=1 Back     alignment and function description
>sp|Q766C3|NEP1_NEPGR Aspartic proteinase nepenthesin-1 OS=Nepenthes gracilis GN=nep1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
255586860 518 Aspartic proteinase nepenthesin-2 precur 0.934 0.359 0.742 1e-76
147839328 585 hypothetical protein VITISV_015700 [Viti 0.959 0.326 0.728 1e-75
224096686 441 predicted protein [Populus trichocarpa] 0.879 0.396 0.758 1e-75
225431324 518 PREDICTED: aspartic proteinase-like prot 0.959 0.368 0.723 2e-75
42567433 524 aspartyl protease family protein [Arabid 0.964 0.366 0.690 7e-72
3805854 455 putative protein [Arabidopsis thaliana] 0.964 0.421 0.690 9e-72
297802338 522 aspartyl protease family protein [Arabid 0.919 0.350 0.720 2e-70
357517921 553 Aspartic proteinase-like protein [Medica 0.924 0.332 0.696 5e-66
449434466 525 PREDICTED: aspartic proteinase-like prot 0.934 0.354 0.664 7e-66
356559244 515 PREDICTED: aspartic proteinase-like prot 0.899 0.347 0.675 9e-65
>gi|255586860|ref|XP_002534040.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus communis] gi|223525947|gb|EEF28344.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 166/194 (85%), Gaps = 8/194 (4%)

Query: 2   IWAVIGPSSCDGGRIFSFEMHHRYSDQVKNWSISSGKLSHSDWPDKGSFDYYALLAHRDQ 61
           +W  + P +C G RIF+F+MHHR+SD +K+ S S+   +  ++P KGSF+YYA LAHRDQ
Sbjct: 16  VW--VFPQNCKG-RIFTFKMHHRFSDMLKDLSDST---TSRNFPSKGSFEYYAELAHRDQ 69

Query: 62  ILRGRHLSDTDTNSPLIFSDGNSTLRISSLGFLHYTTVQLGTPGMKFMVALDTGSDLFWV 121
           +LRGR L + +  +PL FSDGNST RISSLGFLHYTTV+LGTPGMKFMVALDTGSDLFWV
Sbjct: 70  MLRGRKLYNVE--APLAFSDGNSTFRISSLGFLHYTTVELGTPGMKFMVALDTGSDLFWV 127

Query: 122 PCECSKCAPTQGSAYASDFELSIYNPEVSSTSKKVTCNNLLCAHRNRCPGTFSNCPYSVS 181
           PC+CSKCAPTQG AYASDFELSIY+P+ SSTSKKVTCNN LCAHRNRC GTFS+CPY VS
Sbjct: 128 PCDCSKCAPTQGVAYASDFELSIYDPKQSSTSKKVTCNNNLCAHRNRCLGTFSSCPYMVS 187

Query: 182 YVSAQTSTSGILVE 195
           YVSAQTSTSGILVE
Sbjct: 188 YVSAQTSTSGILVE 201

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147839328|emb|CAN63378.1| hypothetical protein VITISV_015700 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224096686|ref|XP_002310698.1| predicted protein [Populus trichocarpa] gi|222853601|gb|EEE91148.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225431324|ref|XP_002269880.1| PREDICTED: aspartic proteinase-like protein 1 [Vitis vinifera] gi|297739017|emb|CBI28369.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|42567433|ref|NP_195313.2| aspartyl protease family protein [Arabidopsis thaliana] gi|190576481|gb|ACE79041.1| At4g35880 [Arabidopsis thaliana] gi|222423134|dbj|BAH19546.1| AT4G35880 [Arabidopsis thaliana] gi|332661184|gb|AEE86584.1| aspartyl protease family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|3805854|emb|CAA21474.1| putative protein [Arabidopsis thaliana] gi|7270540|emb|CAB81497.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297802338|ref|XP_002869053.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata] gi|297314889|gb|EFH45312.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357517921|ref|XP_003629249.1| Aspartic proteinase-like protein [Medicago truncatula] gi|355523271|gb|AET03725.1| Aspartic proteinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449434466|ref|XP_004135017.1| PREDICTED: aspartic proteinase-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356559244|ref|XP_003547910.1| PREDICTED: aspartic proteinase-like protein 1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
TAIR|locus:2125324 524 AT4G35880 [Arabidopsis thalian 0.964 0.366 0.690 1.1e-71
TAIR|locus:2827921 513 AT2G17760 [Arabidopsis thalian 0.894 0.346 0.491 2.1e-45
TAIR|locus:2080973 488 AT3G51360 [Arabidopsis thalian 0.889 0.362 0.479 2e-40
TAIR|locus:2080903 529 AT3G51330 [Arabidopsis thalian 0.924 0.347 0.434 7.8e-39
TAIR|locus:2080913 528 AT3G51350 [Arabidopsis thalian 0.919 0.346 0.397 1.5e-35
TAIR|locus:2080908 530 AT3G51340 [Arabidopsis thalian 0.914 0.343 0.401 1.9e-35
TAIR|locus:2184138 528 AT5G10080 [Arabidopsis thalian 0.884 0.333 0.415 1.9e-32
TAIR|locus:2200365 475 AT1G65240 [Arabidopsis thalian 0.522 0.218 0.350 2.6e-13
TAIR|locus:2075512 488 AT3G02740 [Arabidopsis thalian 0.643 0.262 0.38 2e-12
TAIR|locus:2183617 482 AT5G36260 [Arabidopsis thalian 0.608 0.251 0.352 6.9e-12
TAIR|locus:2125324 AT4G35880 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 725 (260.3 bits), Expect = 1.1e-71, P = 1.1e-71
 Identities = 136/197 (69%), Positives = 165/197 (83%)

Query:     1 PIWAVIGPSSCDGGRIFSFEMHHRYSDQVKNWSISSGKLSHSDWPDKGSFDYYALLAHRD 60
             PI  ++   SC+G RIF+FEMHHR+SD+VK WS S+G+ +   +P KGSF+Y+  L  RD
Sbjct:    14 PILMLLSFGSCNG-RIFTFEMHHRFSDEVKQWSDSTGRFAK--FPPKGSFEYFNALVLRD 70

Query:    61 QILRGRHLSDTDTNSP--LIFSDGNSTLRISSLGFLHYTTVQLGTPGMKFMVALDTGSDL 118
              ++RGR LS++++ S   L FSDGNST RISSLGFLHYTTV+LGTPGM+FMVALDTGSDL
Sbjct:    71 WLIRGRRLSESESESESSLTFSDGNSTSRISSLGFLHYTTVKLGTPGMRFMVALDTGSDL 130

Query:   119 FWVPCECSKCAPTQGSAYASDFELSIYNPEVSSTSKKVTCNNLLCAHRNRCPGTFSNCPY 178
             FWVPC+C KCAPT+G+ YAS+FELSIYNP+VS+T+KKVTCNN LCA RN+C GTFS CPY
Sbjct:   131 FWVPCDCGKCAPTEGATYASEFELSIYNPKVSTTNKKVTCNNSLCAQRNQCLGTFSTCPY 190

Query:   179 SVSYVSAQTSTSGILVE 195
              VSYVSAQTSTSGIL+E
Sbjct:   191 MVSYVSAQTSTSGILME 207
GO:0004190 "aspartic-type endopeptidase activity" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0031225 "anchored to membrane" evidence=TAS
TAIR|locus:2827921 AT2G17760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080973 AT3G51360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080903 AT3G51330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080913 AT3G51350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080908 AT3G51340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184138 AT5G10080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200365 AT1G65240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075512 AT3G02740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2183617 AT5G36260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
cd05471 283 cd05471, pepsin_like, Pepsin-like aspartic proteas 6e-10
PLN03146 431 PLN03146, PLN03146, aspartyl protease family prote 2e-09
pfam00026 316 pfam00026, Asp, Eukaryotic aspartyl protease 1e-06
cd05476 265 cd05476, pepsin_A_like_plant, Chroloplast Nucleoid 2e-06
cd06097 278 cd06097, Aspergillopepsin_like, Aspergillopepsin_l 2e-05
cd05470109 cd05470, pepsin_retropepsin_like, Cellular and ret 3e-05
cd05488 320 cd05488, Proteinase_A_fungi, Fungal Proteinase A , 4e-05
PTZ00165 482 PTZ00165, PTZ00165, aspartyl protease; Provisional 5e-05
cd06096 326 cd06096, Plasmepsin_5, Plasmepsins are a class of 1e-04
cd05472 299 cd05472, cnd41_like, Chloroplast Nucleoids DNA-bin 1e-04
cd05474 295 cd05474, SAP_like, SAPs, pepsin-like proteinases s 6e-04
cd05478 317 cd05478, pepsin_A, Pepsin A, aspartic protease pro 7e-04
cd05477 318 cd05477, gastricsin, Gastricsins, asparate proteas 0.001
cd05485 329 cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsi 0.002
cd05475 273 cd05475, nucellin_like, Nucellins, plant aspartic 0.003
cd05487 326 cd05487, renin_like, Renin stimulates production o 0.004
>gnl|CDD|133138 cd05471, pepsin_like, Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH Back     alignment and domain information 
 Score = 57.0 bits (138), Expect = 6e-10
 Identities = 28/100 (28%), Positives = 40/100 (40%), Gaps = 28/100 (28%)

Query: 96  YTTVQLGTPGMKFMVALDTGSDLFWVPC-ECSKCAPTQGSAYASDFELSIYNPEVSSTSK 154
           Y  + +GTP  KF V  DTGS L WVP   C+ C+  +   +        Y+   SST K
Sbjct: 2   YGEITIGTPPQKFSVIFDTGSSLLWVPSSNCTSCSCQKHPRFK-------YDSSKSSTYK 54

Query: 155 KVTCNNLLCAHRNRCPGTFSNCPYSVSYVSAQTSTSGILV 194
                              + C +S++Y     S +G L 
Sbjct: 55  D------------------TGCTFSITYGD--GSVTGGLG 74

Pepsin-like aspartic proteases are found in mammals, plants, fungi and bacteria. These well known and extensively characterized enzymes include pepsins, chymosin, renin, cathepsins, and fungal aspartic proteases. Several have long been known to be medically (renin, cathepsin D and E, pepsin) or commercially (chymosin) important. Structurally, aspartic proteases are bilobal enzymes, each lobe contributing a catalytic Aspartate residue, with an extended active site cleft localized between the two lobes of the molecule. The N- and C-terminal domains, although structurally related by a 2-fold axis, have only limited sequence homology except the vicinity of the active site. This suggests that the enzymes evolved by an ancient duplication event. Most members of the pepsin family specifically cleave bonds in peptides that are at least six residues in length, with hydrophobic residues in both the P1 and P1' positions. The active site is located at the groove formed by the two lobes, with an extended loop projecting over the cleft to form an 11-residue flap, which encloses substrates and inhibitors in the active site. Specificity is determined by nearest-neighbor hydrophobic residues surrounding the catalytic aspartates, and by three residues in the flap.The enzymes are mostly secreted from cells as inactive proenzymes that activate autocatalytically at acidic pH. This family of aspartate proteases is classified by MEROPS as the peptidase family A1 (pepsin A, clan AA). Length = 283
>gnl|CDD|178691 PLN03146, PLN03146, aspartyl protease family protein; Provisional Back     alignment and domain information
>gnl|CDD|215663 pfam00026, Asp, Eukaryotic aspartyl protease Back     alignment and domain information
>gnl|CDD|133143 cd05476, pepsin_A_like_plant, Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants Back     alignment and domain information
>gnl|CDD|133161 cd06097, Aspergillopepsin_like, Aspergillopepsin_like, aspartic proteases of fungal origin Back     alignment and domain information
>gnl|CDD|133137 cd05470, pepsin_retropepsin_like, Cellular and retroviral pepsin-like aspartate proteases Back     alignment and domain information
>gnl|CDD|133155 cd05488, Proteinase_A_fungi, Fungal Proteinase A , aspartic proteinase superfamily Back     alignment and domain information
>gnl|CDD|240300 PTZ00165, PTZ00165, aspartyl protease; Provisional Back     alignment and domain information
>gnl|CDD|133160 cd06096, Plasmepsin_5, Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite Back     alignment and domain information
>gnl|CDD|133139 cd05472, cnd41_like, Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase Back     alignment and domain information
>gnl|CDD|133141 cd05474, SAP_like, SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins Back     alignment and domain information
>gnl|CDD|133145 cd05478, pepsin_A, Pepsin A, aspartic protease produced in gastric mucosa of mammals Back     alignment and domain information
>gnl|CDD|133144 cd05477, gastricsin, Gastricsins, asparate proteases produced in gastric mucosa Back     alignment and domain information
>gnl|CDD|133152 cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsin family of proteinases Back     alignment and domain information
>gnl|CDD|133142 cd05475, nucellin_like, Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation Back     alignment and domain information
>gnl|CDD|133154 cd05487, renin_like, Renin stimulates production of angiotensin and thus affects blood pressure Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 199
PLN03146 431 aspartyl protease family protein; Provisional 99.98
KOG1339 398 consensus Aspartyl protease [Posttranslational mod 99.9
cd06096 326 Plasmepsin_5 Plasmepsins are a class of aspartic p 99.87
PF14543164 TAXi_N: Xylanase inhibitor N-terminal; PDB: 3HD8_A 99.86
cd05490 325 Cathepsin_D2 Cathepsin_D2, pepsin family of protei 99.76
cd05470109 pepsin_retropepsin_like Cellular and retroviral pe 99.74
cd05487 326 renin_like Renin stimulates production of angioten 99.73
PTZ00147 453 plasmepsin-1; Provisional 99.73
cd05478 317 pepsin_A Pepsin A, aspartic protease produced in g 99.73
PTZ00165 482 aspartyl protease; Provisional 99.72
cd05477 318 gastricsin Gastricsins, asparate proteases produce 99.72
cd06097 278 Aspergillopepsin_like Aspergillopepsin_like, aspar 99.71
cd05485 329 Cathepsin_D_like Cathepsin_D_like, pepsin family o 99.71
cd06098 317 phytepsin Phytepsin, a plant homolog of mammalian 99.71
cd05473 364 beta_secretase_like Beta-secretase, aspartic-acid 99.71
PTZ00013 450 plasmepsin 4 (PM4); Provisional 99.7
cd05486 316 Cathespin_E Cathepsin E, non-lysosomal aspartic pr 99.7
cd05488 320 Proteinase_A_fungi Fungal Proteinase A , aspartic 99.69
cd05475 273 nucellin_like Nucellins, plant aspartic proteases 99.56
cd05471 283 pepsin_like Pepsin-like aspartic proteases, biloba 99.5
cd05489 362 xylanase_inhibitor_I_like TAXI-I inhibits degradat 99.44
PF00026 317 Asp: Eukaryotic aspartyl protease The Prosite entr 99.44
cd05472 299 cnd41_like Chloroplast Nucleoids DNA-binding Prote 98.92
cd05476 265 pepsin_A_like_plant Chroloplast Nucleoids DNA-bind 98.72
cd05474 295 SAP_like SAPs, pepsin-like proteinases secreted fr 98.43
cd0548396 retropepsin_like_bacteria Bacterial aspartate prot 95.44
cd0548491 retropepsin_like_LTR_2 Retropepsins_like_LTR, peps 92.36
TIGR02281121 clan_AA_DTGA clan AA aspartic protease, TIGR02281 84.86
PF00077100 RVP: Retroviral aspartyl protease The Prosite entr 84.36
PF1397572 gag-asp_proteas: gag-polyprotein putative aspartyl 81.88
>PLN03146 aspartyl protease family protein; Provisional Back     alignment and domain information 
Probab=99.98  E-value=1.1e-31  Score=243.30  Aligned_cols=158  Identities=28%  Similarity=0.440  Sum_probs=124.1

Q ss_pred             CCceeEEEEEeecCcccccccccCCCCCCCCCCCCCcHHHHHHHHHhhHHHhcccccCCCCCCcccccCCCceeeeccCC
Q 040861           13 GGRIFSFEMHHRYSDQVKNWSISSGKLSHSDWPDKGSFDYYALLAHRDQILRGRHLSDTDTNSPLIFSDGNSTLRISSLG   92 (199)
Q Consensus        13 ~~~~~~l~l~Hr~s~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~d~~rr~~~l~~~~~~~~~~~~~g~~~~~~~~~~   92 (199)
                      +.++++++|+||++++.       |+++    +..+..++++++++||++ |.+++..... ...++..+.     ...+
T Consensus        21 ~~~~~~~~l~h~~~~~s-------p~~~----~~~~~~~~~~~~~~~~~~-r~~~~~~~~~-~~~~~~~~~-----~~~~   82 (431)
T PLN03146         21 PKGGFTVDLIHRDSPKS-------PFYN----PSETPSQRLRNAFRRSIS-RVNHFRPTDA-SPNDPQSDL-----ISNG   82 (431)
T ss_pred             cCCceEEEEEeCCCCCC-------CCCC----CCCChhHHHHHHHHHHHH-HHHHHhhccc-cCCccccCc-----ccCC
Confidence            46789999999999962       2222    445567899999999998 7666643221 111222221     1234


Q ss_pred             ceEEEEEEeCCCCceEEEEEeCCCCceeEecc-CCCCCCCCCCCccCCCccccCCCCCCCCccccccccccccCCC---C
Q 040861           93 FLHYTTVQLGTPGMKFMVALDTGSDLFWVPCE-CSKCAPTQGSAYASDFELSIYNPEVSSTSKKVTCNNLLCAHRN---R  168 (199)
Q Consensus        93 ~~y~~~v~iGTP~q~~~v~~DTGS~~~Wv~C~-C~~C~~~~~~~~~~~~~~~~fdp~~SsT~~~v~C~s~~C~~~~---~  168 (199)
                      .+|+++|.||||||++.|+|||||+++||||. |..|..+.         ++.|||++|+||+.++|+++.|..+.   .
T Consensus        83 ~~Y~v~i~iGTPpq~~~vi~DTGS~l~Wv~C~~C~~C~~~~---------~~~fdps~SST~~~~~C~s~~C~~~~~~~~  153 (431)
T PLN03146         83 GEYLMNISIGTPPVPILAIADTGSDLIWTQCKPCDDCYKQV---------SPLFDPKKSSTYKDVSCDSSQCQALGNQAS  153 (431)
T ss_pred             ccEEEEEEcCCCCceEEEEECCCCCcceEcCCCCcccccCC---------CCcccCCCCCCCcccCCCCcccccCCCCCC
Confidence            58999999999999999999999999999999 99998654         36999999999999999999998763   3


Q ss_pred             CCCCCCCCceEEEEccCCceEEEEEEEEeeC
Q 040861          169 CPGTFSNCPYSVSYVSAQTSTSGILVEMFFT  199 (199)
Q Consensus       169 C~~~~~~C~y~~~Y~gdgs~~~G~l~~Dtlt  199 (199)
                      |.. ++.|.|.+.| +||+.+.|++++|+|+
T Consensus       154 c~~-~~~c~y~i~Y-gdgs~~~G~l~~Dtlt  182 (431)
T PLN03146        154 CSD-ENTCTYSYSY-GDGSFTKGNLAVETLT  182 (431)
T ss_pred             CCC-CCCCeeEEEe-CCCCceeeEEEEEEEE
Confidence            754 3579999999 9999999999999985

>KOG1339 consensus Aspartyl protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite Back     alignment and domain information
>PF14543 TAXi_N: Xylanase inhibitor N-terminal; PDB: 3HD8_A 3VLB_A 3VLA_A 3AUP_D 1T6G_A 1T6E_X 2B42_A Back     alignment and domain information
>cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases Back     alignment and domain information
>cd05470 pepsin_retropepsin_like Cellular and retroviral pepsin-like aspartate proteases Back     alignment and domain information
>cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure Back     alignment and domain information
>PTZ00147 plasmepsin-1; Provisional Back     alignment and domain information
>cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals Back     alignment and domain information
>PTZ00165 aspartyl protease; Provisional Back     alignment and domain information
>cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa Back     alignment and domain information
>cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin Back     alignment and domain information
>cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases Back     alignment and domain information
>cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins Back     alignment and domain information
>cd05473 beta_secretase_like Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease Back     alignment and domain information
>PTZ00013 plasmepsin 4 (PM4); Provisional Back     alignment and domain information
>cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease Back     alignment and domain information
>cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily Back     alignment and domain information
>cd05475 nucellin_like Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation Back     alignment and domain information
>cd05471 pepsin_like Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH Back     alignment and domain information
>cd05489 xylanase_inhibitor_I_like TAXI-I inhibits degradation of xylan in the cell wall Back     alignment and domain information
>PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 Back     alignment and domain information
>cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase Back     alignment and domain information
>cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants Back     alignment and domain information
>cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins Back     alignment and domain information
>cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family Back     alignment and domain information
>cd05484 retropepsin_like_LTR_2 Retropepsins_like_LTR, pepsin-like aspartate proteases Back     alignment and domain information
>TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family Back     alignment and domain information
>PF00077 RVP: Retroviral aspartyl protease The Prosite entry also includes Pfam:PF00026; InterPro: IPR018061 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13975 gag-asp_proteas: gag-polyprotein putative aspartyl protease Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
3aup_A 403 SBG7S, BG, basic 7S globulin; pepsin-like fold, pl 1e-17
3vla_A 413 EDGP; extracellular, inhibitor, plant protein; HET 8e-16
1t6e_X 381 Xylanase inhibitor; two beta-barrel domain structu 3e-14
2qzx_A 342 Candidapepsin-5; aspartic proteinase, aspartyl pro 3e-09
1j71_A 334 Candidapepsin, aspartic proteinase; candida tropic 4e-09
3pvk_A 342 Candidapepsin-2; hydrolase; 1.27A {Candida albican 6e-09
1oew_A 329 Endothiapepsin; hydrolase, aspartic proteinase mec 1e-08
3c9x_A 329 Trichoderma reesei aspartic protease; aspartic pro 1e-08
2apr_A 325 Rhizopuspepsin; hydrolase (aspartic proteinase); 1 4e-08
3fv3_A 339 SAPP1P-secreted aspartic protease 1; secreted aspa 5e-08
1mpp_A 361 Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu 2e-07
3k1w_A 341 Renin; protease, alternative splicing, aspartyl pr 4e-07
2x0b_A 383 Renin; hydrolase-hormone complex, hydrolase hormon 5e-07
1b5f_A 239 Protein (cardosin A); hydrolase, aspartic proteina 8e-07
3lpj_A 455 Beta-secretase 1; alzheimer'S, aspartyl protease, 1e-06
3psg_A 370 Pepsinogen; hydrolase(acid proteinase zymogen); 1. 1e-06
1lya_A97 Cathepsin D; lysosomal aspartic protease; HET: NAG 1e-06
1qdm_A 478 Prophytepsin; aspartic proteinases, saposin-like d 2e-06
2qp8_A 395 Beta-secretase 1; BACE1, protease, alternative spl 2e-06
1dpj_A 329 Proteinase A; proteinase A, hydrolase-hydrolase in 2e-06
3cms_A 323 Chymosin B; hydrolase, acid proteinase; 2.00A {Bos 3e-06
2bju_A 453 Plasmepsin II; aspartic proteinase, drug design, m 3e-06
2ewy_A 383 Beta-secretase 2; BACE2, aspartic protease, hydrol 3e-06
3qvc_A 451 Histo-aspartic protease; HAP, plasmepsin, zymogen, 4e-06
1tzs_A 351 Cathepsin E; hydrolase, aspartic protease, activat 4e-06
1miq_A 375 Plasmepsin; aspartic proteinase zymogen, domain op 4e-06
1htr_B 329 Gastricsin; aspartyl protease; 1.62A {Homo sapiens 5e-06
1am5_A 324 Pepsin, acid proteinase; aspartyl protease, hydrol 6e-06
1wkr_A 340 Polyporopepsin; hydrolase, hydrolase-hydrolase inh 6e-05
1ibq_A 325 Aspergillopepsin; aspartic proteinase, hydrolase; 8e-05
1bxo_A 323 Protein (penicillopepsin); hydrolase, phosphonate 1e-04
1izd_A 323 Aspartic proteinase; sugar binding, acid protease, 6e-04
>3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Length = 403 Back     alignment and structure
 Score = 79.0 bits (194), Expect = 1e-17
 Identities = 22/107 (20%), Positives = 35/107 (32%), Gaps = 12/107 (11%)

Query: 94  LHYTTVQLGTPGMKFMVALDTGSDLFWVPCE-CSKCAPTQGSAYASDFELSIYNPEVSST 152
           LH+  +Q  TP M+  V +D   +  WV CE                ++    +    S 
Sbjct: 22  LHWANLQKRTPLMQVPVLVDLNGNHLWVNCEQQYSS---------KTYQAPFCHSTQCSR 72

Query: 153 SKKVTCNNLLCAHRNRCPGTFSNCPYSVSYVSAQTSTSGILVEMFFT 199
           +    C +   A R  C    + C    +    Q +  G L E    
Sbjct: 73  ANTHQCLSCPAASRPGCHK--NTCGLMSTNPITQQTGLGELGEDVLA 117
>3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A Length = 413 Back     alignment and structure
>1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A Length = 381 Back     alignment and structure
>2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Length = 342 Back     alignment and structure
>1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Length = 334 Back     alignment and structure
>3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Length = 342 Back     alignment and structure
>1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Length = 329 Back     alignment and structure
>3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Length = 329 Back     alignment and structure
>2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Length = 325 Back     alignment and structure
>3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} PDB: 3tne_A* Length = 339 Back     alignment and structure
>1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Length = 361 Back     alignment and structure
>3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Length = 341 Back     alignment and structure
>2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Length = 383 Back     alignment and structure
>1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Length = 239 Back     alignment and structure
>3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Length = 455 Back     alignment and structure
>3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Length = 370 Back     alignment and structure
>1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* Length = 97 Back     alignment and structure
>1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 Length = 478 Back     alignment and structure
>2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Length = 395 Back     alignment and structure
>1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Length = 329 Back     alignment and structure
>3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Length = 323 Back     alignment and structure
>2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Length = 453 Back     alignment and structure
>2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Length = 383 Back     alignment and structure
>3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Length = 451 Back     alignment and structure
>1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Length = 351 Back     alignment and structure
>1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Length = 375 Back     alignment and structure
>1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Length = 329 Back     alignment and structure
>1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Length = 324 Back     alignment and structure
>1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Length = 340 Back     alignment and structure
>1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Length = 325 Back     alignment and structure
>1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Length = 323 Back     alignment and structure
>1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Length = 323 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
1lya_A97 Cathepsin D; lysosomal aspartic protease; HET: NAG 99.9
1b5f_A 239 Protein (cardosin A); hydrolase, aspartic proteina 99.79
2apr_A 325 Rhizopuspepsin; hydrolase (aspartic proteinase); 1 99.79
3c9x_A 329 Trichoderma reesei aspartic protease; aspartic pro 99.79
1oew_A 329 Endothiapepsin; hydrolase, aspartic proteinase mec 99.79
3vla_A 413 EDGP; extracellular, inhibitor, plant protein; HET 99.78
3psg_A 370 Pepsinogen; hydrolase(acid proteinase zymogen); 1. 99.77
3k1w_A 341 Renin; protease, alternative splicing, aspartyl pr 99.77
1dpj_A 329 Proteinase A; proteinase A, hydrolase-hydrolase in 99.76
2x0b_A 383 Renin; hydrolase-hormone complex, hydrolase hormon 99.76
2bju_A 453 Plasmepsin II; aspartic proteinase, drug design, m 99.76
3cms_A 323 Chymosin B; hydrolase, acid proteinase; 2.00A {Bos 99.75
1mpp_A 361 Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu 99.75
3fv3_A 339 SAPP1P-secreted aspartic protease 1; secreted aspa 99.75
4aa9_A 320 Chymosin; hydrolase, aspartic peptidase, rennet; H 99.74
1tzs_A 351 Cathepsin E; hydrolase, aspartic protease, activat 99.74
1am5_A 324 Pepsin, acid proteinase; aspartyl protease, hydrol 99.73
2qzx_A 342 Candidapepsin-5; aspartic proteinase, aspartyl pro 99.73
1qdm_A 478 Prophytepsin; aspartic proteinases, saposin-like d 99.73
1htr_B 329 Gastricsin; aspartyl protease; 1.62A {Homo sapiens 99.73
2ewy_A 383 Beta-secretase 2; BACE2, aspartic protease, hydrol 99.72
3aup_A 403 SBG7S, BG, basic 7S globulin; pepsin-like fold, pl 99.72
2qp8_A 395 Beta-secretase 1; BACE1, protease, alternative spl 99.72
1j71_A 334 Candidapepsin, aspartic proteinase; candida tropic 99.71
3pvk_A 342 Candidapepsin-2; hydrolase; 1.27A {Candida albican 99.71
1miq_A 375 Plasmepsin; aspartic proteinase zymogen, domain op 99.71
3qvc_A 451 Histo-aspartic protease; HAP, plasmepsin, zymogen, 99.71
3lpj_A 455 Beta-secretase 1; alzheimer'S, aspartyl protease, 99.68
3vf3_A 402 Beta-secretase 1; structure-based drug design, hyd 99.68
1ibq_A 325 Aspergillopepsin; aspartic proteinase, hydrolase; 99.65
1izd_A 323 Aspartic proteinase; sugar binding, acid protease, 99.63
1wkr_A 340 Polyporopepsin; hydrolase, hydrolase-hydrolase inh 99.63
1bxo_A 323 Protein (penicillopepsin); hydrolase, phosphonate 99.63
1yg9_A 330 Aspartic protease BLA G 2; allegren, hydrolase, al 99.57
1t6e_X 381 Xylanase inhibitor; two beta-barrel domain structu 99.49
2hs1_A99 HIV-1 protease; ultra-high resolution active site 84.76
1fmb_A104 EIAV protease; hydrolase (acid proteinase), RNA-di 84.21
3ec0_A99 Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1 80.5
>1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* Back     alignment and structure
Probab=99.90  E-value=5e-24  Score=155.51  Aligned_cols=80  Identities=31%  Similarity=0.520  Sum_probs=71.1

Q ss_pred             ccCCceEEEEEEeCCCCceEEEEEeCCCCceeEecc-CC----CCCCCCCCCccCCCccccCCCCCCCCccccccccccc
Q 040861           89 SSLGFLHYTTVQLGTPGMKFMVALDTGSDLFWVPCE-CS----KCAPTQGSAYASDFELSIYNPEVSSTSKKVTCNNLLC  163 (199)
Q Consensus        89 ~~~~~~y~~~v~iGTP~q~~~v~~DTGS~~~Wv~C~-C~----~C~~~~~~~~~~~~~~~~fdp~~SsT~~~v~C~s~~C  163 (199)
                      ++.+.+|+++|.||||+|+|.|+|||||+++||+|. |.    .|..           ++.|||++|+||+.+       
T Consensus         9 n~~~~~Y~~~i~iGTP~Q~~~v~~DTGSs~lWv~~~~C~~~~~~C~~-----------~~~y~p~~SsT~~~~-------   70 (97)
T 1lya_A            9 NYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWI-----------HHKYNSDKSSTYVKN-------   70 (97)
T ss_dssp             EETTTEEEEEEEETTTTEEEEEEEETTCCCEEEEBTTCCTTCHHHHT-----------SCCBCGGGCTTCEEE-------
T ss_pred             ECCCCeEEEEEEECCCCeEEEEEEeCCCCceEEeEcCccCcccccCC-----------CCCCCchhCCCceeC-------
Confidence            467789999999999999999999999999999999 86    4643           468999999999983       


Q ss_pred             cCCCCCCCCCCCCceEEEEccCCceEEEEEEEEeeC
Q 040861          164 AHRNRCPGTFSNCPYSVSYVSAQTSTSGILVEMFFT  199 (199)
Q Consensus       164 ~~~~~C~~~~~~C~y~~~Y~gdgs~~~G~l~~Dtlt  199 (199)
                                 .|.|.+.| +||+ +.|++++|+|+
T Consensus        71 -----------~~~~~i~Y-g~Gs-~~G~~~~Dtv~   93 (97)
T 1lya_A           71 -----------GTSFDIHY-GSGS-LSGYLSQDTVS   93 (97)
T ss_dssp             -----------EEEEEEEC-SSCE-EEEEEEEEEEE
T ss_pred             -----------CCcEEEEE-CCcE-EEEEEEEEEEE
Confidence                       58999999 9887 88999999984
>1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Back     alignment and structure
>2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Back     alignment and structure
>3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Back     alignment and structure
>1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Back     alignment and structure
>3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A Back     alignment and structure
>3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Back     alignment and structure
>3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Back     alignment and structure
>1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Back     alignment and structure
>2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Back     alignment and structure
>2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Back     alignment and structure
>3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Back     alignment and structure
>1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Back     alignment and structure
>3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* Back     alignment and structure
>4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A Back     alignment and structure
>1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Back     alignment and structure
>1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Back     alignment and structure
>2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Back     alignment and structure
>1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 Back     alignment and structure
>1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Back     alignment and structure
>2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Back     alignment and structure
>3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Back     alignment and structure
>2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Back     alignment and structure
>1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Back     alignment and structure
>3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Back     alignment and structure
>1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Back     alignment and structure
>3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Back     alignment and structure
>3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 4fse_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Back     alignment and structure
>3vf3_A Beta-secretase 1; structure-based drug design, hydrolase-hydrolase inhibitor C; HET: 0GS; 1.48A {Homo sapiens} PDB: 2f3e_A* 2f3f_A* 1ym2_A* 3dv1_A* 3dv5_A* 3k5c_A* 3k5f_A* 3k5g_A* 3pi5_A* 3qbh_A* 3duy_A* 3veu_A* 3vg1_A* 4d83_A* 4d88_A* 4d89_A* 4d8c_A* 3msk_A* 3k5d_A* 1ym4_A* ... Back     alignment and structure
>1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Back     alignment and structure
>1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Back     alignment and structure
>1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Back     alignment and structure
>1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Back     alignment and structure
>1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Back     alignment and structure
>1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A Back     alignment and structure
>2hs1_A HIV-1 protease; ultra-high resolution active site surface binding site, HYDR; HET: 017; 0.84A {Human immunodeficiency virus 1} PDB: 3nu4_A* 3tl9_A* 3tkw_A* 3tkg_A* 3ndu_A* 3ndt_A* 3k4v_A* 3a2o_A* 1fgc_C* 2a1e_A* 2aod_A* 2aoi_A* 2aoj_A* 2hb3_A* 2ien_A* 1sdt_A* 2z4o_A* 2zye_A* 2nmw_A* 3b7v_A* ... Back     alignment and structure
>1fmb_A EIAV protease; hydrolase (acid proteinase), RNA-directed DNA polymerase, AS protease, endonuclease, polyprotein; HET: HYB; 1.80A {Equine infectious anemia virus} SCOP: b.50.1.1 PDB: 2fmb_A* Back     alignment and structure
>3ec0_A Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1.18A {Human immunodeficiency virus type 2} SCOP: b.50.1.1 PDB: 1hii_A* 1hsi_A 1hsh_A* 1idb_A* 1jld_A* 2mip_A 1ida_A* 3ebz_A* 3ecg_A* 3s45_A* 4upj_A* 1ivq_A* 1ivp_A 2hpf_A 3upj_A* 2hpe_A* 5upj_A* 6upj_A* 1sip_A 1tcw_A* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 199
d1mppa_ 357 b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840] 2e-12
d1am5a_ 324 b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus mo 3e-12
d2bjua1 329 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrad 5e-12
d1dpja_ 329 b.50.1.2 (A:) Acid protease {Baker's yeast (Saccha 3e-11
d1eaga_ 342 b.50.1.2 (A:) Acid protease {Yeast (Candida albica 4e-11
d1qdma2 337 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase 4e-11
d1j71a_ 334 b.50.1.2 (A:) Acid protease {Yeast (Candida tropic 6e-11
d1miqa_ 373 b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading e 1e-10
d1hrna_ 337 b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Ho 1e-10
d3cmsa_ 323 b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos 2e-10
g1lya.1 338 b.50.1.2 (A:,B:) Cathepsin D {Human (Homo sapiens) 2e-10
g1b5f.1 326 b.50.1.2 (A:,B:) Plant acid proteinase, phytepsin 2e-10
d2qp8a1 387 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Hum 3e-10
d1oewa_ 330 b.50.1.2 (A:) Endothiapepsin {Chestnut blight fung 7e-10
d2apra_ 325 b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus 1e-09
d1smra_ 335 b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mu 2e-09
g1htr.1 372 b.50.1.2 (P:,B:) Pepsin(ogen) {Human (Homo sapiens 4e-09
d1t6ex_ 381 b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Tr 3e-08
d1wkra_ 340 b.50.1.2 (A:) Acid protease {Irpex lacteus (Polypo 4e-08
d1bxoa_ 323 b.50.1.2 (A:) Acid protease {Fungus (Penicillium j 3e-06
d3psga_ 370 b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxI 4e-06
d1izea_ 323 b.50.1.2 (A:) Acid protease {Fungus (Aspergillus o 9e-06
>d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Length = 357 Back     information, alignment and structure

class: All beta proteins
fold: Acid proteases
superfamily: Acid proteases
family: Pepsin-like
domain: Pepsin
species: Mucor pusillus [TaxId: 4840]

 Score = 62.7 bits (151), Expect = 2e-12
 Identities = 24/105 (22%), Positives = 37/105 (35%), Gaps = 9/105 (8%)

Query: 96  YTTVQLGTPGMKFMVALDTGSDLFWVPC-ECSKCAPTQGSAYASDFELSIYNPEVSSTSK 154
              V +GTPG  F +  DTGS   WVP   C       G  +        ++P  SST K
Sbjct: 17  AIPVSIGTPGQDFYLLFDTGSSDTWVPHKGCDNSEGCVGKRF--------FDPSSSSTFK 68

Query: 155 KVTCNNLLCAHRNRCPGTFSNCPYSVSYVSAQTSTSGILVEMFFT 199
           +   N  +        G +     +V   + +  T   +  +   
Sbjct: 69  ETDYNLNITYGTGGANGIYFRDSITVGGATVKQQTLAYVDNVSGP 113
>d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Length = 324 Back     information, alignment and structure
>d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Length = 329 Back     information, alignment and structure
>d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Length = 329 Back     information, alignment and structure
>d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Length = 342 Back     information, alignment and structure
>d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 337 Back     information, alignment and structure
>d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 334 Back     information, alignment and structure
>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Length = 373 Back     information, alignment and structure
>d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Length = 323 Back     information, alignment and structure
>d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Length = 387 Back     information, alignment and structure
>d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Length = 325 Back     information, alignment and structure
>d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Length = 335 Back     information, alignment and structure
>d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 381 Back     information, alignment and structure
>d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Length = 340 Back     information, alignment and structure
>d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Length = 323 Back     information, alignment and structure
>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Length = 370 Back     information, alignment and structure
>d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Length = 323 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
d1qdma2 337 Plant acid proteinase, phytepsin {Barley (Hordeum 99.79
d3psga_ 370 Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} 99.79
d2apra_ 325 Acid protease {Bread mold (Rhizopus chinensis) [Ta 99.78
d1miqa_ 373 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 99.77
d1dpja_ 329 Acid protease {Baker's yeast (Saccharomyces cerevi 99.77
d1smra_ 335 Chymosin (synonym: renin) {Mouse (Mus musculus) [T 99.77
d2bjua1 329 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 99.77
g1htr.1 372 Pepsin(ogen) {Human (Homo sapiens), progastricsin 99.76
d1oewa_ 330 Endothiapepsin {Chestnut blight fungus (Endothia p 99.76
g1lya.1 338 Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1am5a_ 324 Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 99.74
d3cmsa_ 323 Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId 99.74
d1hrna_ 337 Chymosin (synonym: renin) {Human (Homo sapiens) [T 99.73
g1b5f.1 326 Plant acid proteinase, phytepsin {Cynara carduncul 99.71
d1mppa_ 357 Pepsin {Mucor pusillus [TaxId: 4840]} 99.7
d1eaga_ 342 Acid protease {Yeast (Candida albicans) [TaxId: 54 99.7
d1j71a_ 334 Acid protease {Yeast (Candida tropicalis) [TaxId: 99.69
d2qp8a1 387 beta-secretase (memapsin) {Human (Homo sapiens) [T 99.64
d1bxoa_ 323 Acid protease {Fungus (Penicillium janthinellum), 99.6
d1izea_ 323 Acid protease {Fungus (Aspergillus oryzae) [TaxId: 99.6
d1wkra_ 340 Acid protease {Irpex lacteus (Polyporus tulipifera 99.47
d1t6ex_ 381 Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu 99.43
>d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
class: All beta proteins
fold: Acid proteases
superfamily: Acid proteases
family: Pepsin-like
domain: Plant acid proteinase, phytepsin
species: Barley (Hordeum vulgare) [TaxId: 4513]

Probab=99.79  E-value=8.9e-20  Score=152.63  Aligned_cols=86  Identities=31%  Similarity=0.488  Sum_probs=73.3

Q ss_pred             eee-ccCCceEEEEEEeCCCCceEEEEEeCCCCceeEecc-CCCCCCCCCCCccCCCccccCCCCCCCCccccccccccc
Q 040861           86 LRI-SSLGFLHYTTVQLGTPGMKFMVALDTGSDLFWVPCE-CSKCAPTQGSAYASDFELSIYNPEVSSTSKKVTCNNLLC  163 (199)
Q Consensus        86 ~~~-~~~~~~y~~~v~iGTP~q~~~v~~DTGS~~~Wv~C~-C~~C~~~~~~~~~~~~~~~~fdp~~SsT~~~v~C~s~~C  163 (199)
                      +++ ++.+.+|+++|.||||||++.|++||||+++||+|. |..|..        +..++.|||++|+|++.        
T Consensus         7 ~~l~~y~d~~Y~~~v~iGtP~q~~~l~~DTGS~~~Wv~~~~C~~~~~--------~~~~~~y~p~~SsT~~~--------   70 (337)
T d1qdma2           7 VALKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIA--------CYLHSRYKAGASSTYKK--------   70 (337)
T ss_dssp             GGGCCGGGCCEEEEEEETTTTEEEEEEEETTCCCCEEEBTTCCSCGG--------GGGSCCBCGGGCTTCBC--------
T ss_pred             EeeeeecCCEEEEEEEEcCCCEEEEEEEECCCcceEEecCCCCCCcc--------ccCCCCCCcccCCcccc--------
Confidence            344 788889999999999999999999999999999999 987643        12346899999999987        


Q ss_pred             cCCCCCCCCCCCCceEEEEccCCceEEEEEEEEeeC
Q 040861          164 AHRNRCPGTFSNCPYSVSYVSAQTSTSGILVEMFFT  199 (199)
Q Consensus       164 ~~~~~C~~~~~~C~y~~~Y~gdgs~~~G~l~~Dtlt  199 (199)
                                ..|.|.+.| ++| ...|.+++|+++
T Consensus        71 ----------~~~~~~~~y-~~g-s~~G~~~~d~~~   94 (337)
T d1qdma2          71 ----------NGKPAAIQY-GTG-SIAGYFSEDSVT   94 (337)
T ss_dssp             ----------CCCEEEEEE-TTE-EEEEEEEEEEEE
T ss_pred             ----------CCceEEEec-CCc-eEEEEEEeeeEE
Confidence                      469999999 866 678999999874
>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Back     information, alignment and structure
>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Back     information, alignment and structure
>d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Back     information, alignment and structure
>d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Back     information, alignment and structure
>d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Back     information, alignment and structure
>d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Back     information, alignment and structure
>d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Back     information, alignment and structure
>d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Back     information, alignment and structure
>d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure