Citrus Sinensis ID: 040937

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------51

MANHLYGYSSSYGAGGGGGTPKSSAALSGVYTSRSLADAYHLSESTLRYDPDHSIYDSFRYSGYLSSQAQQPWPPGVDPTDHLKRPSEALYHPTLLGTHTSIGQSEAWYSTNSLAKRPRIESASNLPVYPQRPGEKDCAYYMQTRTCKFGDTCKFDHPIWVPEGGIPDWKEVPVIASSESLPERPGEPDCPYFLKTQRCKFGSKCKFNHPKDKLIGSSDSGNGDVSALPERPSEPPCAFYLKNGTCKFGATCKFDHPKDFQLPSVGQENGIGEQNESVIKTDETTGLLNPGMSLFSHAPAMLHNSKGLPIRPGELDCPFYLKTGSCKYGSTCRYNHPERTAINPPAAAIVHPLITSPAASLGISVVSPAASLYQTIDPRLAQATLGVSPSLYPQRPGQMECDYYMKTGVCKFGEKCKFHHPIDRSAAKTPSQETVKLTLAGLPRREGAVHCPYYMKTGTCKYGATCKFDHPPPGEVMAISALDGTSTAVGEEVKGDEKESEVAPSTAV

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

***********************************LADAYHLSESTLRYDPDHSIYDSFRYSGY*************************LYHPTLLGTHTSIGQSEAWYS*************************KDCAYYMQTRTCKFGDTCKFDHPI******************************CPYFLKTQRCKFGSKCKF************************PSEPPCAFYLKNGTCKFGATCKFDHP*************************************************GLPIRPGELDCPFYLKTGSCKYGSTCRYNHPERTAINPPAAAIVHPLITSPAASLGISVVSPAASLY******************YPQRPGQMECDYYMKTGVCKFGEKCKFHHPID***********VKLTLAGLPRREGAVHCPYYMKTGTCKYGATCKFDH**************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Zinc finger CCCH domain-containing protein 37	Involved in flower development. Functions in floral reproductive organ identity by binding AGAMOUS pre-mRNA and promoting its processing.	probable	Q941Q3
Zinc finger CCCH domain-containing protein 8		probable	Q5ZDJ6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M9O, chain A
Confidence level:very confident
Coverage over the Query: 130-163,178-180
View the alignment between query and template
View the model in PyMOL

Template: 1M9O, chain A
Confidence level:very confident
Coverage over the Query: 395-429,442-441
View the alignment between query and template
View the model in PyMOL

Template: 2RHK, chain C
Confidence level:very confident
Coverage over the Query: 185-214,233-259
View the alignment between query and template
View the model in PyMOL

Template: 3U9G, chain A
Confidence level:probable
Coverage over the Query: 189-256,316-339
View the alignment between query and template
View the model in PyMOL