Citrus Sinensis ID: 041011

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310---
MNEAASISIAEKHEKWMAEHGRSYKDELEKDMRFKIFKQNLEYIDKVNNNNNSNEGINRTYQLGTNQFSDLTNAEFRASYAGNSMAITSQHSSFKYQNLTQVPTSMDWREKGAVTSIKNQGGCAACWAFSAVAAVEGITQISSGNLIRLSEQQLLDCSSNGNSGCVAGKSDIAFKYIIKNQGIATEADYPYHQVQGSCGREHAAAAKISSYEVLPSGDEQALLKAVSMQPVSINIEGTGQDFKNYKGGIFNGVCGTQLDHAVTIIGFGTTEDGTKYWLIKNSWGDTWGEAGYMRIQRDEGLCGIGTQAAYPIT
cccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHcccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccEEECccEEEcccccHHHHHHHHccccEEEEECcccccccccccccccccccccccEEEEEEEEcccccccEEEEEEcccccccccccEEEEEccccccccccccccccc
*****SI*IAEKHEKWMAEHGRSYKDELEKDMRFKIFKQNLEYIDKVNNNNNSNEGINRTYQLGTNQFSDLTNAEFRASYA************FKYQNLTQVPTSMDWREKGAVTSIKNQGGCAACWAFSAVAAVEGITQISSGNLIRLSEQQLLDCSSNGNSGCVAGKSDIAFKYIIKNQGIATEADYPYHQVQGSCGREHAAAAKISSYEVLPSGDEQALLKAVSMQPVSINIEGTGQDFKNYKGGIFNGVCGTQLDHAVTIIGFGTTEDGTKYWLIKNSWGDTWGEAGYMRIQRDEGLCGIGTQAAYPIT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNEAASISIAEKHEKWMAEHGRSYKDELEKDMRFKIFKQNLEYIDKVNNNNNSNEGINRTYQLGTNQFSDLTNAEFRASYAGNSMAITSQHSSFKYQNLTQVPTSMDWREKGAVTSIKNQGGCAACWAFSAVAAVEGITQISSGNLIRLSEQQLLDCSSNGNSGCVAGKSDIAFKYIIKNQGIATEADYPYHQVQGSCGREHAAAAKISSYEVLPSGDEQALLKAVSMQPVSINIEGTGQDFKNYKGGIFNGVCGTQLDHAVTIIGFGTTEDGTKYWLIKNSWGDTWGEAGYMRIQRDEGLCGIGTQAAYPIT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cathepsin S Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.probableP25774
Cathepsin S Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.probableQ8HY81
Cysteine proteinase 3 probableQ23894

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PCI, chain A
Confidence level:very confident
Coverage over the Query: 4-313
View the alignment between query and template
View the model in PyMOL