Citrus Sinensis ID: 041050

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41

MHVLFYDTGFEPGASAAEDIAEIRKLLQNEIHMRKTAEEELNKLKSRLGQYTESGSCRDAEMSKLHKTLEDETLQKRKLEEEIVILRSQLLQLTFEADQMQKCLERGEFGNTFTGLDKHSQFRDSGNGQKAPITKLFEQVGLHKILSLLESEDANVRIHAVKVVANLAAEEANQEKIVEAGGLSSLLMLLRSFEDETIRRVAAGAIANLAMNAEANQELIMAQGGISLLSTTAADAEDPQTLRMVAGAIANLCGNDKLQMKLRSEGGIRALLGMVRCGHPDVLSQVARGIANFAKCESRAATQVRFIRCTATGVKSGRSLLIEDGALPWIVQNANNEAAPIRRHIELALCHLAQHEVNAREMISGGALWELVRISRDCSREDIRSLAHRTLSSSLTFRAEMRRLRIEF

cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHcc

*HVLFYDTGF*********IAEIRKL******************************************************EEIVILRSQLLQLTFEADQMQKCLERGEFGNTFTGLDKHS***********PITKLFEQVGLHKILSLLESEDANVRIHAVKVVANLAAEEANQEKIVEAGGLSSLLMLLRSFEDETIRRVAAGAIANLAMNAEANQELIMAQGGISLLSTTAADAEDPQTLRMVAGAIANLCGNDKLQMKLRSEGGIRALLGMVRCGHPDVLSQVARGIANFAKCESRAATQVRFIRCTATGVKSGRSLLIEDGALPWIVQNANNEAAPIRRHIELALCHLAQHEVNAREMISGGALWELVRISRDCSREDIRSLAHRTLSSSLTFRAEMRRLRIEF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MHVLFYDTGFEPGASAAEDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGSCRDAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxADQMQKCLERGEFGNTFTGLDKHSQFRDSGNGQKAPITKLFEQVGLHKILSLLESEDANVRIHAVKVVANLAAEEANQEKIVEAGGLSSLLMLLRSFEDETIRRVAAGAIANLAMNAEANQELIMAQGGISLLSTTAADAEDPQTLRMVAGAIANLCGNDKLQMKLRSEGGIRALLGMVRCGHPDVLSQVARGIANFAKCESRAATQVRFIRCTATGVKSGRSLLIEDGALPWIVQNANNEAAPIRRHIELALCHLAQHEVNAREMISGGALWELVRISRDCSREDIRSLAHRTLSSSLTFRAEMRRLRIEF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Armadillo repeat-containing kinesin-like protein 2	Involved in the control of epidermal-cell morphogenesis in roots and helical growth of roots by promoting microtubule depolymerization and limiting the accumulation of endoplasmic microtubules. Seems to be involved in the control of cell-file rotation (or twisting).	probable	Q9LPC6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z6H, chain A
Confidence level:very confident
Coverage over the Query: 142-391
View the alignment between query and template
View the model in PyMOL

Template: 1JDH, chain A
Confidence level:very confident
Coverage over the Query: 121-405
View the alignment between query and template
View the model in PyMOL

Template: 4B8J, chain A
Confidence level:confident
Coverage over the Query: 78-295,313-405
View the alignment between query and template
View the model in PyMOL

Template: 3SWK, chain A
Confidence level:probable
Coverage over the Query: 20-44,59-94
View the alignment between query and template
View the model in PyMOL