Citrus Sinensis ID: 041057


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
RRPHVVNGGGFVVTDCSQKIIFRVDGCGVLGTKGELVVRHADGDAVVLIRRKGGVVEALSIHKKWKGYAFDYEGSKKLVFTLKEPPSSSCLVRNSSIRISTETTARSSNFEVKGYFPDRDCIIVDPSGNIVAQIGVKKEIQDLMESKDLYHIVVKPGIDQAFVVGVIATLDYIYGESTRC
cccEEEEcccEEEEcccccEEEEECccccccccccEEEEcccccEEEEEEEcccEEEEEccccEEEEEEEccccccEEEEEEEcccccccCECccEEEEECcccccccCEEEEECccccCEEEEcccccEEEEEEEEEEEcEEEEEccEEEEEEEccccHHHHHHHHHHHHHHccccccc
*RPHVVNGGGFVVTDCSQKIIFRVDGCGVLGTKGELVVRHADGDAVVLIRRKGGVVEALSIHKKWKGYAFDYEGSKKLVFTLKEPPS**CLVRNSSIRISTETTARSSNFEVKGYFPDRDCIIVDPSGNIVAQIGVKKEIQDLMESKDLYHIVVKPGIDQAFVVGVIATLDYIYG*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RRPHVVNGGGFVVTDCSQKIIFRVDGCGVLGTKGELVVRHADGDAVVLIRRKGGVVEALSIHKKWKGYAFDYEGSKKLVFTLKEPPSSSCLVRNSSIRISTETTARSSNFEVKGYFPDRDCIIVDPSGNIVAQIGVKKEIQDLMESKDLYHIVVKPGIDQAFVVGVIATLDYIYGESTRC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein LURP-one-related 6 Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.probableQ9ZUF7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZXU, chain A
Confidence level:very confident
Coverage over the Query: 8-51,63-84,95-175
View the alignment between query and template
View the model in PyMOL