Citrus Sinensis ID: 041063


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490
NQLTLKPTLYIGRNRIQCLDFCKKRERGGKKKRHKREKSQLSKMEEPTEGASLVSGPDGKKRRVSYFYEPTIGDYYYGQGHPMKPHRIRMAHNLIVHYGLHRRMEVNRPFPAGPSDIRRFHTDEYVEFLASVSPESSGDPSFSRHLKRFNVGEDCPVFDGLFGFCQASAGGSIGAAVKLNRGDADIAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLKVHRRVLYVDIDVHHGDGVEEAFYTTDRVMTVSFHKFGDFFPGTGHIKDVGAGQGKFYALNVPLNDGLDDESFRGLFRPIIQKVMEVYQPDAVVLQCGADSLSGDRLGCFNLSVKGHADCLRFLRSFNVPLMVLGGGGYTIRNVARCWCYETAVAVGVEPDNKLPYNEYYEYFGPDYTLHVEPCNMENLNAHKDMEKIRNTLLEQLSGLIHAPSVPFQTTPATTQVPEEPEEDMERRPKPRIWNGEDYESDHDEDDKPPHMANFDDHMMRQ
cccccccccccccccccccHHHHHHccccccccccHHcccccccccccccccccccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHHccccccccccccccccHHHHHHcccHHHHHHHHccccccccccccHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccEEEEcccccccccccccccccCCcHHHHHHHHHHHcccEEEEEEcccccccccHHHccccccEEEEEcccccccccccccccccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccHHHHHHHHHHHHHccccCEEEcccccccccccHHHHHHHHHHcccccccccccccHHHHcccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccc
*****KPTLYIGRNRIQCLDFCK***************************************RVSYFYEPTIGDYYYGQGHPMKPHRIRMAHNLIVHYGLHRRMEVNRPFPAGPSDIRRFHTDEYVEFLASVSPESSGDPSFSRHLKRFNVGEDCPVFDGLFGFCQASAGGSIGAAVKLNRGDADIAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLKVHRRVLYVDIDVHHGDGVEEAFYTTDRVMTVSFHKFGDFFPGTGHIKDVGAGQGKFYALNVPLNDGLDDESFRGLFRPIIQKVMEVYQPDAVVLQCGADSLSGDRLGCFNLSVKGHADCLRFLRSFNVPLMVLGGGGYTIRNVARCWCYETAVAVGVEPDNKLPYNEYYEYFGPDYTLHVEPCNMENLNAHKDMEKIRNTLLEQLSGLIHAPSVPFQTT***************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NQLTLKPTLYIGRNRIQCLDFCKKRERGGKKKRHKREKSQLSKMEEPTEGASLVSGPDGKKRRVSYFYEPTIGDYYYGQGHPMKPHRIRMAHNLIVHYGLHRRMEVNRPFPAGPSDIRRFHTDEYVEFLASVSPESSGDPSFSRHLKRFNVGEDCPVFDGLFGFCQASAGGSIGAAVKLNRGDADIAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLKVHRRVLYVDIDVHHGDGVEEAFYTTDRVMTVSFHKFGDFFPGTGHIKDVGAGQGKFYALNVPLNDGLDDESFRGLFRPIIQKVMEVYQPDAVVLQCGADSLSGDRLGCFNLSVKGHADCLRFLRSFNVPLMVLGGGGYTIRNVARCWCYETAVAVGVEPDNKLPYNEYYEYFGPDYTLHVEPCNMENLNAHKDMEKIRNTLLEQLSGLIHAPSVPFQTTPATTQVPEEPEEDMERRPKPRIWNGEDYESDHDEDDKPPHMANFDDHMMRQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone deacetylase 6 Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Might remove acetyl residues only from specific targets, such as rDNA repeats or complex transgenes. Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Required for rRNA gene silencing in nucleolar dominance. Plays a role in transgene silencing, but this effect seems to bee independent of the histone deacetylase activity.confidentQ9FML2
Histone deacetylase 1 Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in the endoderm determination possibly by repressing end-1 expression. Also involved in vulval development, possibly by repressing lag-2 expression.probableO17695
Histone deacetylase clr6 Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Has a role in chromatin assembly and chromosome segregation.probableO59702

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.5.-.-Acting on carbon-nitrogen bonds, other than peptide bonds.probable
3.5.1.-11-cis-retinol dehydrogenase.probable
3.5.1.98Histone deacetylase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MAX, chain A
Confidence level:very confident
Coverage over the Query: 61-428
View the alignment between query and template
View the model in PyMOL