Citrus Sinensis ID: 041074

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450--

GTSAAVPDWLNKGDNAWQMISATLVGLQSVPGLVILYGSIVKKKWAVNSAFMALYAFAAVVICWATWAYKMSFGDKLLPFWGKAGPALGQKFLIKQSALPETTQFHDDGSVETAMVLPFYPMASMVWFQCVFAAITLVILAGSVLGRMNIKAWMAFVPLWLTFSYTVGAFSLWGGGFLFHWGVMDYSGGYVIHLSSGIAGFTAAYWVGPRSTKDRERFPPNNVIMMLAGAGLLWMGWAGFNGGDPYTANIDSSMAVLNTNICAATSLLVWTWLDVIFFKKPSVIGAVQGMITGLVCITPGAGLVQGWAAIVMGILSGSVPWFTMMFIHKRWTLLQKIDDTLSVFHTHAVAGLLGGVLTGLFAEPKLCSLFLPVTNSRGGVYGGSGGIQILKQLAGAAFIIGWNVVVTSIICVIINKVIPLRMTEEQLLIGDDAVHGEEAYALWGDGEKYDST

cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEECccccccccccccccHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccHHccccccccccccEEEccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccHHHHccccccccccccccccc

****AVPDWLNKGDNAWQMISATLVGLQSVPGLVILYGSIVKKKWAVNSAFMALYAFAAVVICWATWAYKMSFGDKLLPFWGKAGPALGQKFLIKQSALPETTQFHDDGSVETAMVLPFYPMASMVWFQCVFAAITLVILAGSVLGRMNIKAWMAFVPLWLTFSYTVGAFSLWGGGFLFHWGVMDYSGGYVIHLSSGIAGFTAAYWVGPRSTKDRERFPPNNVIMMLAGAGLLWMGWAGFNGGDPYTANIDSSMAVLNTNICAATSLLVWTWLDVIFFKKPSVIGAVQGMITGLVCITPGAGLVQGWAAIVMGILSGSVPWFTMMFIHKRWTLLQKIDDTLSVFHTHAVAGLLGGVLTGLFAEPKLCSLFLPVTNSRGGVYGGSGGIQILKQLAGAAFIIGWNVVVTSIICVIINKVIPLRMTEEQLLIGDDAVHGEEAYALWG*G******

xxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ammonium transporter 3 member 1	Involved in ammonium transport.	confident	Q84KJ6
Ammonium transporter 2	High affinity ammonium transporter that may play an important role in moving ammonium between the apoplast and symplast of cells throughout the plant. Does not transport methylammonium.	confident	Q9M6N7
Ammonia channel	Involved in the uptake of ammonia.	probable	O66515

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B2H, chain A
Confidence level:very confident
Coverage over the Query: 10-100,119-441
View the alignment between query and template
View the model in PyMOL

Template: 2NPD, chain A
Confidence level:confident
Coverage over the Query: 8-75,89-206,220-377,388-423
View the alignment between query and template
View the model in PyMOL