Citrus Sinensis ID: 041087

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
MSTCLLILLITFAEANQADNLDKLIKSKRLKDCPLAELQADEKEYYSAANTYIKPQQNGLMQADKIKLLPGQSNGVDFDQYSGYVTVDPKSGRSLFYYFAESPQNSSTNPSLLWLDGGPGCSSLAYGAVTESGSFRMNKDGKTLFRNNYAWNNGDKTLRLGKRDILGIQRGWGFGTQVQLRTISLMVKNSMIKIHIPFLIKWLERNTKECSDSRDEAADEIGDIDIYNICAPICISPTFGNGSLGSASLS
ccHHHHHHHHHHHHHcHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEEEEEcccccccccEEEEEccccccccccHHHHHHcccEEEccccccccccccccccccEEEEEccccccccccccEEEEcccccccEEccHHHHHHHHHHHHHHHHHHcccccccccEEEcccccccHHHHHHHHHHcccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHccccccccHHHHEccccccccccccccEEEEEEEEEccccEEEEEEEEcccHHHccccEEEEEcccccEcccccHHHHccccEEEcHHHccEEEccccHHHccEEEEHHHHHEHcccccccEEEccccccHcccccHHHHHHHHHHHHHHHHHccccccccEEEEEcccccccHHHHHHHHHHcccccEEEEcccccc
MSTCLLILLITFAEANQADNLDKLikskrlkdcplaeLQADEKEYYSAANtyikpqqnglmqadkikllpgqsngvdfdqysgyvtvdpksgrSLFYYFaespqnsstnpsllwldggpgcsslaygavtesgsfrmnkdgktlfrnnyawnngdktlrlgkrdilgiqrgwgfgtQVQLRTISLMVKNSMIKIHIPFLIKWLERNtkecsdsrdeaadeigdidiynicapicisptfgngslgsasls
MSTCLLILLITfaeanqadnldklikskrlkdCPLAELQADEKEYYSAANTYIKPQQNGLMQADKIKLLPGQSNGVDFDQYSGYVTVDPKSGRSLFYYFAESPQNSSTNPSLLWLDGGPGCSSLAYGAVTESGSFRMNKdgktlfrnnyawnngdktlrlGKRDILGIqrgwgfgtqVQLRTISLMVKNSMIKIHIPFLIKWLERNTKECSDSRDEAADEIGDIDIYNICAPICISptfgngslgsasls
MSTCLLILLITFAEANQADNLDKLIKSKRLKDCPLAELQADEKEYYSAANTYIKPQQNGLMQADKIKLLPGQSNGVDFDQYSGYVTVDPKSGRSLFYYFAESPQNSSTNPSLLWLDGGPGCSSLAYGAVTESGSFRMNKDGKTLFRNNYAWNNGDKTLRLGKRDILGIQRGWGFGTQVQLRTISLMVKNSMIKIHIPFLIKWLERNTKECSDSRdeaadeigdidiYNICAPICISPTFGNGSLGSASLS
**TCLLILLITFAEANQADNLDKLIKSKRLKDCPLAELQADEKEYYSAANTYIKPQQNGLMQADKIKLLPGQSNGVDFDQYSGYVTVDPKSGRSLFYYFA**********SLLWLDGGPGCSSLAYGAVTESGSFRMNKDGKTLFRNNYAWNNGDKTLRLGKRDILGIQRGWGFGTQVQLRTISLMVKNSMIKIHIPFLIKWLERNTK*********ADEIGDIDIYNICAPICISPTFG**********
MSTCLLILLITFAEANQADN************************YYS******************IKLLPGQSNGVDFDQYSGYVTVDPKSGRSLFYYFAESPQNSSTNPSLLWLDGGPGCSSLAYGAVTESGSFRMNKDGKTLFRNNYAWNNGDKTLRLGKRDILGIQRGWGFGTQVQLRTISLMVKNSMIKIHIPFLIKWLERNTKECSDSRDEAADEIGDIDIYNICAPICIS**************
MSTCLLILLITFAEANQADNLDKLIKSKRLKDCPLAELQADEKEYYSAANTYIKPQQNGLMQADKIKLLPGQSNGVDFDQYSGYVTVDPKSGRSLFYYFAESPQNSSTNPSLLWLDGGPGCSSLAYGAVTESGSFRMNKDGKTLFRNNYAWNNGDKTLRLGKRDILGIQRGWGFGTQVQLRTISLMVKNSMIKIHIPFLIKWLERNT*********AADEIGDIDIYNICAPICISPTFGNG********
MSTCLLILLITFAEANQADNLDKLIKSKR******************************LMQADKIKLLPGQSNGVDFDQYSGYVTVDPKSGRSLFYYFAESPQNSSTNPSLLWLDGGPGCSSLAYGAVTESGSFRMNKDGKTLFRNNYAWNNGDKTLRLGKRDILGIQRGWGFGTQVQLRTISLMVKNSMIKIHIPFLIKWLERNTKECSDSRDEAADEIGDIDIYNICAPICISPTFGNGSLGSASLS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTCLLILLITFAEANQADNLDKLIKSKRLKDCPLAELQADEKEYYSAANTYIKPQQNGLMQADKIKLLPGQSNGVDFDQYSGYVTVDPKSGRSLFYYFAESPQNSSTNPSLLWLDGGPGCSSLAYGAVTESGSFRMNKDGKTLFRNNYAWNNGDKTLRLGKRDILGIQRGWGFGTQVQLRTISLMVKNSMIKIHIPFLIKWLERNTKECSDSRDEAADEIGDIDIYNICAPICISPTFGNGSLGSASLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query250 2.2.26 [Sep-21-2011]
Q0WRX3 502 Serine carboxypeptidase-l yes no 0.584 0.290 0.477 1e-31
Q8S8K6 462 Serine carboxypeptidase-l no no 0.54 0.292 0.482 5e-28
P52711 516 Serine carboxypeptidase I N/A no 0.564 0.273 0.449 5e-28
Q9ZQQ0 452 Serine carboxypeptidase-l no no 0.552 0.305 0.424 1e-26
Q9ZUG3 487 Serine carboxypeptidase-l no no 0.548 0.281 0.421 2e-25
Q9SFB5 459 Serine carboxypeptidase-l no no 0.592 0.322 0.409 4e-25
O82229 454 Putative serine carboxype no no 0.548 0.301 0.444 4e-25
Q9SV02 501 Serine carboxypeptidase-l no no 0.776 0.387 0.392 8e-25
P08819 444 Serine carboxypeptidase 2 N/A no 0.544 0.306 0.447 2e-24
Q9LXY6264 Putative serine carboxype no no 0.78 0.738 0.356 2e-24
>sp|Q0WRX3|SCP40_ARATH Serine carboxypeptidase-like 40 OS=Arabidopsis thaliana GN=SCPL40 PE=2 SV=2 Back     alignment and function desciption
 Score =  136 bits (343), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 76/159 (47%), Positives = 93/159 (58%), Gaps = 13/159 (8%)

Query: 47  SAANTYIKPQQNGLMQADKIKLLPGQSNGVDFDQYSGYVTVDPKSGRSLFYYFAESPQNS 106
           SAAN      Q GL + D I+ LPGQ   V FDQY GYVTV+  +GRS FYYF E+ ++ 
Sbjct: 69  SAAN------QEGLRKRDLIRRLPGQPP-VSFDQYGGYVTVNESAGRSFFYYFVEASKSK 121

Query: 107 STNPSLLWLDGGPGCSSLAYGAVTESGSFRMNKDGKTLFRNNYAWNNGDKTLRLGKRDIL 166
            ++P LLWL+GGPGCSSLAYGA+ E G FR++ DGKTLFRN YAWNN    L       L
Sbjct: 122 DSSPLLLWLNGGPGCSSLAYGALQELGPFRVHSDGKTLFRNRYAWNNAANVL------FL 175

Query: 167 GIQRGWGFGTQVQLRTISLMVKNSMIKIHIPFLIKWLER 205
               G GF        +      +    +  FL+ WLER
Sbjct: 176 ESPAGVGFSYTNTTSDLEKHGDRNTAADNYIFLVNWLER 214
Probable carboxypeptidase.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: -
>sp|Q8S8K6|SCP28_ARATH Serine carboxypeptidase-like 28 OS=Arabidopsis thaliana GN=SCPL28 PE=2 SV=2 Back     alignment and function description
>sp|P52711|CBP23_HORVU Serine carboxypeptidase II-3 OS=Hordeum vulgare GN=CXP;2-3 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZQQ0|SCP26_ARATH Serine carboxypeptidase-like 26 OS=Arabidopsis thaliana GN=SCPL26 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZUG3|SCP38_ARATH Serine carboxypeptidase-like 38 OS=Arabidopsis thaliana GN=SCPL38 PE=2 SV=1 Back     alignment and function description
>sp|Q9SFB5|SCP27_ARATH Serine carboxypeptidase-like 27 OS=Arabidopsis thaliana GN=SCPL27 PE=2 SV=1 Back     alignment and function description
>sp|O82229|SCP23_ARATH Putative serine carboxypeptidase-like 23 OS=Arabidopsis thaliana GN=SCPL23 PE=2 SV=2 Back     alignment and function description
>sp|Q9SV02|SCP39_ARATH Serine carboxypeptidase-like 39 OS=Arabidopsis thaliana GN=SCPL39 PE=2 SV=1 Back     alignment and function description
>sp|P08819|CBP2_WHEAT Serine carboxypeptidase 2 OS=Triticum aestivum GN=CBP2 PE=1 SV=2 Back     alignment and function description
>sp|Q9LXY6|SCP53_ARATH Putative serine carboxypeptidase-like 53 OS=Arabidopsis thaliana GN=SCPL53 PE=5 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query250
356545706 493 PREDICTED: serine carboxypeptidase II-3- 0.792 0.401 0.468 6e-43
225458529 488 PREDICTED: serine carboxypeptidase II-3- 0.744 0.381 0.5 1e-42
302142365 1017 unnamed protein product [Vitis vinifera] 0.744 0.182 0.5 2e-42
357443925 497 Serine carboxypeptidase-like protein [Me 0.788 0.396 0.476 7e-42
357443931 493 Serine carboxypeptidase II-3 [Medicago t 0.776 0.393 0.475 9e-42
357443921 495 Serine carboxypeptidase II-3 [Medicago t 0.768 0.387 0.475 1e-41
357443923 495 Serine carboxypeptidase-like protein [Me 0.768 0.387 0.475 2e-41
356547865 491 PREDICTED: serine carboxypeptidase II-3- 0.748 0.380 0.489 2e-41
357443919 495 Serine carboxypeptidase II-3 [Medicago t 0.768 0.387 0.485 2e-41
357462111 497 Serine carboxypeptidase-like protein [Me 0.788 0.396 0.471 3e-41
>gi|356545706|ref|XP_003541277.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max] Back     alignment and taxonomy information
 Score =  180 bits (456), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 98/209 (46%), Positives = 125/209 (59%), Gaps = 11/209 (5%)

Query: 1   MSTCLL----ILLITFAEANQADNLDKLIKSKRLKDCPLAELQADEKEYYSAANTYIKPQ 56
           +  C+L    ++L+ +++A+QAD L +LI SK  +  P+    A+E    + +  Y+ PQ
Sbjct: 6   LYACMLNLSILILLPYSKASQADKLQELILSKSSQKPPVTLSWAEEDAVKTPSPAYVAPQ 65

Query: 57  QNGLMQADKIKLLPGQSNGVDFDQYSGYVTVDPKSGRSLFYYFAESPQNSSTNPSLLWLD 116
           + G  +AD+I  LPGQ  GV+FDQYSGYVTVDPK+GR+LFYYF ESP N ST P +LWL+
Sbjct: 66  E-GQKEADRIVALPGQPYGVNFDQYSGYVTVDPKAGRALFYYFVESPYNPSTKPLVLWLN 124

Query: 117 GGPGCSSLAYGAVTESGSFRMNKDGKTLFRNNYAWNNGDKTLRLGKRDILGIQRGWGFGT 176
           GGPGCSSL YGA  E G FR+N DG+TL+RN YAWN     L L          G GF  
Sbjct: 125 GGPGCSSLGYGAFEELGPFRINSDGETLYRNKYAWNEVANVLFLES------PAGVGFSY 178

Query: 177 QVQLRTISLMVKNSMIKIHIPFLIKWLER 205
                        S  K    FLI WLER
Sbjct: 179 SNTTSDYGHSGDKSTAKDAYVFLINWLER 207

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225458529|ref|XP_002282331.1| PREDICTED: serine carboxypeptidase II-3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142365|emb|CBI19568.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357443925|ref|XP_003592240.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355481288|gb|AES62491.1| Serine carboxypeptidase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357443931|ref|XP_003592243.1| Serine carboxypeptidase II-3 [Medicago truncatula] gi|357462117|ref|XP_003601340.1| Serine carboxypeptidase II-3 [Medicago truncatula] gi|355481291|gb|AES62494.1| Serine carboxypeptidase II-3 [Medicago truncatula] gi|355490388|gb|AES71591.1| Serine carboxypeptidase II-3 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357443921|ref|XP_003592238.1| Serine carboxypeptidase II-3 [Medicago truncatula] gi|357462107|ref|XP_003601335.1| Serine carboxypeptidase II-3 [Medicago truncatula] gi|355481286|gb|AES62489.1| Serine carboxypeptidase II-3 [Medicago truncatula] gi|355490383|gb|AES71586.1| Serine carboxypeptidase II-3 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357443923|ref|XP_003592239.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|357462109|ref|XP_003601336.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355481287|gb|AES62490.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355490384|gb|AES71587.1| Serine carboxypeptidase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356547865|ref|XP_003542325.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max] Back     alignment and taxonomy information
>gi|357443919|ref|XP_003592237.1| Serine carboxypeptidase II-3 [Medicago truncatula] gi|357462105|ref|XP_003601334.1| Serine carboxypeptidase II-3 [Medicago truncatula] gi|355481285|gb|AES62488.1| Serine carboxypeptidase II-3 [Medicago truncatula] gi|355490382|gb|AES71585.1| Serine carboxypeptidase II-3 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357462111|ref|XP_003601337.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355490385|gb|AES71588.1| Serine carboxypeptidase-like protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query250
TAIR|locus:2087368 502 scpl40 "serine carboxypeptidas 0.564 0.280 0.5 1.1e-34
TAIR|locus:2083720 501 scpl39 "serine carboxypeptidas 0.784 0.391 0.396 1.3e-28
TAIR|locus:2058734 462 scpl28 "serine carboxypeptidas 0.54 0.292 0.482 1.9e-28
TAIR|locus:2078598 473 scpl25 "serine carboxypeptidas 0.548 0.289 0.437 2.2e-27
TAIR|locus:2064737 487 scpl38 "serine carboxypeptidas 0.572 0.293 0.397 3.8e-27
TAIR|locus:2083705 487 scpl37 "serine carboxypeptidas 0.764 0.392 0.330 1.1e-26
TAIR|locus:2061436 464 scpl22 "serine carboxypeptidas 0.548 0.295 0.434 2.6e-26
TAIR|locus:2083695 482 scpl36 "serine carboxypeptidas 0.532 0.275 0.419 2.8e-26
TAIR|locus:2039275 452 scpl26 "serine carboxypeptidas 0.552 0.305 0.424 3.7e-26
TAIR|locus:2102634264 AT3G56540 [Arabidopsis thalian 0.776 0.734 0.369 6.6e-26
TAIR|locus:2087368 scpl40 "serine carboxypeptidase-like 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 344 (126.2 bits), Expect = 1.1e-34, Sum P(2) = 1.1e-34
 Identities = 75/150 (50%), Positives = 95/150 (63%)

Query:    57 QNGLMQADKIKLLPGQSNGVDFDQYSGYVTVDPKSGRSLFYYFAESPQNSSTNPSLLWLD 116
             Q GL + D I+ LPGQ   V FDQY GYVTV+  +GRS FYYF E+ ++  ++P LLWL+
Sbjct:    73 QEGLRKRDLIRRLPGQPP-VSFDQYGGYVTVNESAGRSFFYYFVEASKSKDSSPLLLWLN 131

Query:   117 GGPGCSSLAYGAVTESGSFRMNKDGKTLFRNNYAWNNGDKTLRLGKRDILGIQRGWGF-G 175
             GGPGCSSLAYGA+ E G FR++ DGKTLFRN YAWNN    L L      G+  G+ +  
Sbjct:   132 GGPGCSSLAYGALQELGPFRVHSDGKTLFRNRYAWNNAANVLFL--ESPAGV--GFSYTN 187

Query:   176 TQVQLRTISLMVKNSMIKIHIPFLIKWLER 205
             T   L       +N+    +I FL+ WLER
Sbjct:   188 TTSDLEKHG--DRNTAADNYI-FLVNWLER 214
GO:0004185 "serine-type carboxypeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
TAIR|locus:2083720 scpl39 "serine carboxypeptidase-like 39" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058734 scpl28 "serine carboxypeptidase-like 28" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078598 scpl25 "serine carboxypeptidase-like 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2064737 scpl38 "serine carboxypeptidase-like 38" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083705 scpl37 "serine carboxypeptidase-like 37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061436 scpl22 "serine carboxypeptidase-like 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083695 scpl36 "serine carboxypeptidase-like 36" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039275 scpl26 "serine carboxypeptidase-like 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102634 AT3G56540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.16LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00014760001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (988 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
pfam00450 415 pfam00450, Peptidase_S10, Serine carboxypeptidase 6e-32
PTZ00472 462 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1) 2e-13
PLN03016 433 PLN03016, PLN03016, sinapoylglucose-malate O-sinap 2e-13
COG2939 498 COG2939, COG2939, Carboxypeptidase C (cathepsin A) 6e-12
PLN02209 437 PLN02209, PLN02209, serine carboxypeptidase 2e-11
>gnl|CDD|215926 pfam00450, Peptidase_S10, Serine carboxypeptidase Back     alignment and domain information 
 Score =  120 bits (304), Expect = 6e-32
 Identities = 46/84 (54%), Positives = 56/84 (66%), Gaps = 2/84 (2%)

Query: 70  PGQSNGVDFDQYSGYVTVDPKSGRSLFYYFAESPQNSSTNPSLLWLDGGPGCSSLAYGAV 129
           PG    + F QYSGY+TVD  +GRSLFY+F ES  N   +P +LWL+GGPGCSSL  G  
Sbjct: 1   PGLDGPLPFKQYSGYLTVDESAGRSLFYWFFESENNPENDPLVLWLNGGPGCSSL-GGLF 59

Query: 130 TESGSFRMNKDGKTLFRNNYAWNN 153
            E G FR+N  G TL+ N Y+WN 
Sbjct: 60  EELGPFRVN-SGPTLYLNPYSWNK 82

Length = 415
>gnl|CDD|240429 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>gnl|CDD|178590 PLN03016, PLN03016, sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>gnl|CDD|225490 COG2939, COG2939, Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|177859 PLN02209, PLN02209, serine carboxypeptidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 250
KOG1282 454 consensus Serine carboxypeptidases (lysosomal cath 100.0
PF00450 415 Peptidase_S10: Serine carboxypeptidase; InterPro: 100.0
PLN02209 437 serine carboxypeptidase 100.0
PLN03016 433 sinapoylglucose-malate O-sinapoyltransferase 100.0
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 100.0
COG2939 498 Carboxypeptidase C (cathepsin A) [Amino acid trans 100.0
KOG1283 414 consensus Serine carboxypeptidases [Posttranslatio 99.96
PLN02213 319 sinapoylglucose-malate O-sinapoyltransferase/ carb 99.8
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 96.95
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 96.56
TIGR03611 257 RutD pyrimidine utilization protein D. This protei 96.19
PRK00870 302 haloalkane dehalogenase; Provisional 95.84
PHA02857 276 monoglyceride lipase; Provisional 95.52
PRK10673 255 acyl-CoA esterase; Provisional 95.2
PLN02298 330 hydrolase, alpha/beta fold family protein 94.85
PLN02385 349 hydrolase; alpha/beta fold family protein 94.63
PLN02824 294 hydrolase, alpha/beta fold family protein 94.58
TIGR01249 306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 94.39
TIGR02427 251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 94.21
TIGR03056 278 bchO_mg_che_rel putative magnesium chelatase acces 93.17
PLN02652 395 hydrolase; alpha/beta fold family protein 93.11
PRK05077 414 frsA fermentation/respiration switch protein; Revi 92.82
PF12697 228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 91.83
TIGR02240 276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 91.8
KOG1455 313 consensus Lysophospholipase [Lipid transport and m 91.65
PF10340 374 DUF2424: Protein of unknown function (DUF2424); In 90.49
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 90.31
PRK10749 330 lysophospholipase L2; Provisional 89.76
PRK05855 582 short chain dehydrogenase; Validated 89.16
PRK11126 242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 89.04
PLN02894 402 hydrolase, alpha/beta fold family protein 87.9
PLN02679 360 hydrolase, alpha/beta fold family protein 87.87
TIGR03343 282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 87.57
KOG4409 365 consensus Predicted hydrolase/acyltransferase (alp 87.23
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 87.21
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 86.6
TIGR03695 251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 86.53
PLN02211 273 methyl indole-3-acetate methyltransferase 85.76
PRK10566 249 esterase; Provisional 85.67
PRK10115 686 protease 2; Provisional 85.5
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 85.3
TIGR03101 266 hydr2_PEP hydrolase, ortholog 2, exosortase system 85.25
COG0596 282 MhpC Predicted hydrolases or acyltransferases (alp 84.33
PRK03204 286 haloalkane dehalogenase; Provisional 83.9
KOG2100 755 consensus Dipeptidyl aminopeptidase [Posttranslati 83.82
PLN03084 383 alpha/beta hydrolase fold protein; Provisional 83.81
PF00561 230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 83.31
PRK03592 295 haloalkane dehalogenase; Provisional 81.95
PLN02511 388 hydrolase 81.94
PRK06489 360 hypothetical protein; Provisional 81.43
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=9.1e-59  Score=447.07  Aligned_cols=179  Identities=38%  Similarity=0.641  Sum_probs=162.1

Q ss_pred             CcccCCccccCCCCCCCCCceeEEeEEEecCCCCceEEEEEEecCCCCCCCCceEeeCCCCcchhhhhhhhhhhCCeEEc
Q 041087           59 GLMQADKIKLLPGQSNGVDFDQYSGYVTVDPKSGRSLFYYFAESPQNSSTNPSLLWLDGGPGCSSLAYGAVTESGSFRMN  138 (250)
Q Consensus        59 ~~~~~d~V~~LPG~~~~v~~~~ysGyv~v~~~~~~~lFY~f~ea~~~~~~~PlvlWlNGGPGcSSl~~g~~~e~GP~~v~  138 (250)
                      ..+++|+|+.|||++.+++|++|||||+|+++.+++|||||+||+++|+++||||||||||||||++ |+|.|+|||+|+
T Consensus        23 ~~~~~~~I~~LPG~~~~~~f~~ysGYv~v~~~~~~~LFYwf~eS~~~P~~dPlvLWLnGGPGCSSl~-G~~~E~GPf~v~  101 (454)
T KOG1282|consen   23 HVDEADLIKSLPGQPGPLPFKQYSGYVTVNESEGRQLFYWFFESENNPETDPLVLWLNGGPGCSSLG-GLFEENGPFRVK  101 (454)
T ss_pred             ccchhhhhhcCCCCCCCCCcccccceEECCCCCCceEEEEEEEccCCCCCCCEEEEeCCCCCccchh-hhhhhcCCeEEc
Confidence            3588899999999998899999999999999889999999999999999999999999999999996 999999999999


Q ss_pred             CCCCeeeecCCCCcCCCceeeeecCcccceeecccCCccccccchhhhhchHHHHHHHHHHHHHHHhccccccccccccc
Q 041087          139 KDGKTLFRNNYAWNNGDKTLRLGKRDILGIQRGWGFGTQVQLRTISLMVKNSMIKIHIPFLIKWLERNTKECSDSRDEAA  218 (250)
Q Consensus       139 ~~~~~l~~N~~SW~~~anlLfID~PvGtGfS~~~~~~~~~~~~~~~~~V~~~~a~~~~~fl~~fl~~~P~y~~~~l~i~g  218 (250)
                      .+|.+|..|+||||+.||||||||||||||||.....   +.. .+   |+.+|+++++||++||++||+|..++|||+|
T Consensus       102 ~~G~tL~~N~ySWnk~aNiLfLd~PvGvGFSYs~~~~---~~~-~~---D~~~A~d~~~FL~~wf~kfPey~~~~fyI~G  174 (454)
T KOG1282|consen  102 YNGKTLYLNPYSWNKEANILFLDQPVGVGFSYSNTSS---DYK-TG---DDGTAKDNYEFLQKWFEKFPEYKSNDFYIAG  174 (454)
T ss_pred             CCCCcceeCCccccccccEEEEecCCcCCccccCCCC---cCc-CC---cHHHHHHHHHHHHHHHHhChhhcCCCeEEec
Confidence            9999999999999999999999999999999975322   222 22   2478999999999999999999999999999


Q ss_pred             cccCCceeccccccccc------CC-------cccCCCCC
Q 041087          219 DEIGDIDIYNICAPICI------SP-------TFGNGSLG  245 (250)
Q Consensus       219 ESYgG~~ip~ia~~~~~------~~-------~~~~~~~~  245 (250)
                      |||||+|||.||+.|.+      .|       +||||.+.
T Consensus       175 ESYAG~YVP~La~~I~~~N~~~~~~~iNLkG~~IGNg~td  214 (454)
T KOG1282|consen  175 ESYAGHYVPALAQEILKGNKKCCKPNINLKGYAIGNGLTD  214 (454)
T ss_pred             ccccceehHHHHHHHHhccccccCCcccceEEEecCcccC
Confidence            99999999999998842      22       88999775

>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
1bcr_A263 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 5e-26
3sc2_A259 Refined Atomic Model Of Wheat Serine Carboxypeptida 5e-26
1whs_A255 Structure Of The Complex Of L-Benzylsuccinate With 6e-26
1wht_A256 Structure Of The Complex Of L-Benzylsuccinate With 6e-26
1gxs_A270 Crystal Structure Of Hydroxynitrile Lyase From Sorg 9e-23
1ivy_A 452 Physiological Dimer Hpp Precursor Length = 452 3e-15
4az0_A 300 Crystal Structure Of Cathepsin A, Complexed With 8a 5e-15
1ac5_A 483 Crystal Structure Of Kex1(delta)p, A Prohormone-pro 2e-09
1wpx_A 421 Crystal Structure Of Carboxypeptidase Y Inhibitor C 2e-07
1cpy_A 421 Site-Directed Mutagenesis On (Serine) Carboxypeptid 8e-07
>pdb|1BCR|A Chain A, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 263 Back     alignment and structure 
Iteration: 1

 Score =  114 bits (285), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 64/143 (44%), Positives = 76/143 (53%), Gaps = 7/143 (4%)
Query: 63  ADKIKLLPGQSNGVDFDQYSGYVTVDPKSGRSLFYYFAESPQNSSTNPSLLWLDGGPGCS 122
           AD+I  LPGQ   VDFD YSGY+TVD  +GRSLFY   E+P+++   P +LWL+GGPGCS
Sbjct: 8   ADRIARLPGQP-AVDFDMYSGYITVDEGAGRSLFYLLQEAPEDAQPAPLVLWLNGGPGCS 66
Query: 123 SLAYGAVTESGSFRMNKDGKTLFRNNYAWNNGDKTLRLGKRDILGIQRGWGFGTQVQLRT 182
           S+AYGA  E G+FR+   G  L  N Y WN     L       L    G GF        
Sbjct: 67  SVAYGASEELGAFRVKPRGAGLVLNEYRWNKVANVL------FLDSPAGVGFSYTNTSSD 120
Query: 183 ISLMVKNSMIKIHIPFLIKWLER 205
           I     N        FL KW ER
Sbjct: 121 IYTSGDNRTAHDSYAFLAKWFER 143
>pdb|3SC2|A Chain A, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|1WHS|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 255 Back     alignment and structure
>pdb|1WHT|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 256 Back     alignment and structure
>pdb|1GXS|A Chain A, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 270 Back     alignment and structure
>pdb|1IVY|A Chain A, Physiological Dimer Hpp Precursor Length = 452 Back     alignment and structure
>pdb|4AZ0|A Chain A, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 300 Back     alignment and structure
>pdb|1AC5|A Chain A, Crystal Structure Of Kex1(delta)p, A Prohormone-processing Carboxypeptidase From Saccharomyces Cerevisiae Length = 483 Back     alignment and structure
>pdb|1WPX|A Chain A, Crystal Structure Of Carboxypeptidase Y Inhibitor Complexed With The Cognate Proteinase Length = 421 Back     alignment and structure
>pdb|1CPY|A Chain A, Site-Directed Mutagenesis On (Serine) Carboxypeptidase Y From Yeast. The Significance Of Thr 60 And Met 398 In Hydrolysis And Aminolysis Reactions Length = 421 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 3e-42
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 6e-42
1ivy_A 452 Human protective protein; carboxypeptidase, serine 1e-36
1cpy_A 421 Serine carboxypeptidase; hydrolase (carboxypeptida 6e-32
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 8e-28
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Length = 255 Back     alignment and structure
 Score =  143 bits (363), Expect = 3e-42
 Identities = 51/91 (56%), Positives = 63/91 (69%), Gaps = 1/91 (1%)

Query: 63  ADKIKLLPGQSNGVDFDQYSGYVTVDPKSGRSLFYYFAESPQNSSTNPSLLWLDGGPGCS 122
           AD+I  LPGQ   VDFD YSGY+TVD  +GRSLFY   E+P+++   P +LWL+GGPGCS
Sbjct: 3   ADRIARLPGQP-AVDFDMYSGYITVDEGAGRSLFYLLQEAPEDAQPAPLVLWLNGGPGCS 61

Query: 123 SLAYGAVTESGSFRMNKDGKTLFRNNYAWNN 153
           S+AYGA  E G+FR+   G  L  N Y WN 
Sbjct: 62  SVAYGASEELGAFRVKPRGAGLVLNEYRWNK 92
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 270 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Length = 452 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Length = 421 Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Length = 483 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query250
4az3_A 300 Lysosomal protective protein 32 kDa chain; hydrola 100.0
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 100.0
1ivy_A 452 Human protective protein; carboxypeptidase, serine 100.0
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 100.0
1cpy_A 421 Serine carboxypeptidase; hydrolase (carboxypeptida 100.0
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 96.95
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 96.7
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 96.64
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 96.48
3fcy_A 346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 96.42
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 96.35
2wtm_A 251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 96.28
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 96.25
3llc_A 270 Putative hydrolase; structural genomics, joint cen 96.21
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 96.01
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 95.97
3pfb_A 270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 95.95
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 95.93
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 95.91
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 95.83
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 95.83
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 95.74
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 95.66
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 95.62
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 95.6
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 95.53
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 95.52
3e0x_A 245 Lipase-esterase related protein; APC60309, clostri 95.47
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 95.39
1l7a_A 318 Cephalosporin C deacetylase; structural genomics, 95.37
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 95.24
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 95.21
3fla_A 267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 95.07
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 95.03
1vlq_A 337 Acetyl xylan esterase; TM0077, structural genomics 94.98
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 94.97
4dnp_A 269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 94.94
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 94.84
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 94.83
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 94.71
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 94.7
2jbw_A 386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 94.59
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 94.57
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 94.56
3sty_A 267 Methylketone synthase 1; alpha/beta hydrolase, dec 94.54
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 94.38
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 94.36
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 94.35
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 94.31
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 94.22
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 94.16
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 94.16
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 94.06
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 94.05
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 94.04
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 94.01
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.97
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 93.85
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 93.81
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 93.8
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 93.79
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 93.78
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 93.77
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 93.75
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 93.74
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 93.73
3rm3_A 270 MGLP, thermostable monoacylglycerol lipase; alpha/ 93.69
3mve_A 415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 93.67
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 93.65
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 93.63
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 93.62
2ocg_A 254 Valacyclovir hydrolase; alpha beta hydrolase fold; 93.57
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 93.54
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 93.52
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 92.56
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 93.44
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 93.37
2qmq_A 286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 93.35
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 93.33
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 93.32
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 93.26
1iup_A 282 META-cleavage product hydrolase; aromatic compound 93.12
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 93.1
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 92.96
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 92.95
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 92.83
3h04_A 275 Uncharacterized protein; protein with unknown func 92.8
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 92.78
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 92.77
3dqz_A 258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 92.72
2puj_A 286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 92.63
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 92.61
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 92.54
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 92.52
3qmv_A 280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 92.49
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 92.41
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 92.29
2xt0_A 297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 92.28
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 92.28
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 92.06
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 92.02
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 92.01
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 92.01
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 91.96
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 91.94
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 91.89
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 91.63
3d0k_A 304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 91.43
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 91.31
3qyj_A 291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 91.27
3dkr_A 251 Esterase D; alpha beta hydrolase, mechanism, catal 91.21
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 91.01
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 90.91
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 90.83
3vis_A 306 Esterase; alpha/beta-hydrolase fold, polyethylene 90.78
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 90.72
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 90.65
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 90.55
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 90.51
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 90.38
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 90.36
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 90.09
3nuz_A 398 Putative acetyl xylan esterase; structural genomic 90.01
3fnb_A 405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 89.89
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 89.88
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 89.63
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 89.59
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 89.22
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 89.14
2wfl_A 264 Polyneuridine-aldehyde esterase; alkaloid metaboli 88.94
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 88.43
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 88.16
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 87.97
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 87.74
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 87.7
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 87.42
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 87.23
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 86.93
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 86.7
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 86.68
1r3d_A 264 Conserved hypothetical protein VC1974; structural 86.32
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 86.22
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 86.15
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 85.89
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 85.65
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 85.39
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 85.34
1jfr_A 262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 85.16
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 85.12
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 85.08
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 84.92
3bjr_A 283 Putative carboxylesterase; structural genomics, jo 84.54
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 84.14
3ain_A323 303AA long hypothetical esterase; carboxylesterase 84.07
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 82.15
3ils_A 265 PKS, aflatoxin biosynthesis polyketide synthase; A 81.5
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 81.32
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 81.22
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 80.87
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 80.67
3g8y_A 391 SUSD/RAGB-associated esterase-like protein; struct 80.61
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 80.57
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 80.48
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
Probab=100.00  E-value=9.2e-57  Score=412.84  Aligned_cols=175  Identities=29%  Similarity=0.437  Sum_probs=158.2

Q ss_pred             cccCCccccCCCCCCCCCceeEEeEEEecCCCCceEEEEEEecCCCCCCCCceEeeCCCCcchhhhhhhhhhhCCeEEcC
Q 041087           60 LMQADKIKLLPGQSNGVDFDQYSGYVTVDPKSGRSLFYYFAESPQNSSTNPSLLWLDGGPGCSSLAYGAVTESGSFRMNK  139 (250)
Q Consensus        60 ~~~~d~V~~LPG~~~~v~~~~ysGyv~v~~~~~~~lFY~f~ea~~~~~~~PlvlWlNGGPGcSSl~~g~~~e~GP~~v~~  139 (250)
                      ++++|+|++|||++.++++++|||||+|++  +++|||||||++++|+++||+|||||||||||+ +|+|+|+|||+|+.
T Consensus         3 ap~~d~V~~LPG~~~~~~~~~ysGyv~v~~--~~~lFywf~es~~~p~~~Pl~lWlnGGPGcSS~-~g~~~E~GP~~~~~   79 (300)
T 4az3_A            3 APDQDEIQRLPGLAKQPSFRQYSGYLKGSG--SKHLHYWFVESQKDPENSPVVLWLNGGPGCSSL-DGLLTEHGPFLVQP   79 (300)
T ss_dssp             CCGGGBCCCCTTBSSCCSSCEEEEEEECST--TEEEEEEEECCSSCTTTSCEEEEECCTTTBCTH-HHHHHTTSSEEECT
T ss_pred             CCCcCccccCcCcCCCCCcceeeeeeecCC--CCeEEEEEEEcCCCCCCCCEEEEECCCCcHHHH-HHHHhcCCCceecC
Confidence            578899999999998899999999999974  689999999999999999999999999999999 69999999999999


Q ss_pred             CCCeeeecCCCCcCCCceeeeecCcccceeecccCCccccccchhhhhchHHHHHHHHHHHHHHHhcccccccccccccc
Q 041087          140 DGKTLFRNNYAWNNGDKTLRLGKRDILGIQRGWGFGTQVQLRTISLMVKNSMIKIHIPFLIKWLERNTKECSDSRDEAAD  219 (250)
Q Consensus       140 ~~~~l~~N~~SW~~~anlLfID~PvGtGfS~~~~~~~~~~~~~~~~~V~~~~a~~~~~fl~~fl~~~P~y~~~~l~i~gE  219 (250)
                      ++.+++.|++||++.||||||||||||||||+.....   ..+.     .+++++++.||++|+++||+|..+++||+||
T Consensus        80 ~~~~l~~N~~sW~~~an~lfiD~PvGtGfSy~~~~~~---~~~~-----~~~a~d~~~fl~~f~~~fp~~~~~~~yi~GE  151 (300)
T 4az3_A           80 DGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFY---ATND-----TEVAQSNFEALQDFFRLFPEYKNNKLFLTGE  151 (300)
T ss_dssp             TSSCEEECTTCGGGSSEEEEECCSTTSTTCEETTCCC---CCBH-----HHHHHHHHHHHHHHHHHCGGGTTSCEEEEEE
T ss_pred             CCccccccCccHHhhhcchhhcCCCcccccccCCCcc---cccc-----hhhHHHHHHHHHHHHHhChhhcCCceEEEec
Confidence            9889999999999999999999999999999863221   1222     3568899999999999999999999999999


Q ss_pred             ccCCceeccccccccc-------CCcccCCCCC
Q 041087          220 EIGDIDIYNICAPICI-------SPTFGNGSLG  245 (250)
Q Consensus       220 SYgG~~ip~ia~~~~~-------~~~~~~~~~~  245 (250)
                      ||||+|||.||..+-+       +..||||.+.
T Consensus       152 SY~G~yvP~~a~~i~~~~~inLkG~~iGNg~~d  184 (300)
T 4az3_A          152 SYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSS  184 (300)
T ss_dssp             TTHHHHHHHHHHHHTTCTTSCEEEEEEESCCSB
T ss_pred             CCceeeHHHHHHHHHhCCCcccccceecCCccC
Confidence            9999999999998864       3488998764
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 250
g1wht.1 409 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat 5e-35
g1gxs.1 425 c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (So 2e-34
d1ivya_ 452 c.69.1.5 (A:) Human 'protective protein', HPP {Hum 1e-31
d1wpxa1 421 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak 2e-24
d1ac5a_ 483 c.69.1.5 (A:) Serine carboxypeptidase II {Baker's 1e-19
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Length = 452 Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Length = 483 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query250
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 100.0
g1wht.1 409 Serine carboxypeptidase II {Wheat (Triticum vulgar 100.0
g1gxs.1 425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 100.0
d1wpxa1 421 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1ac5a_ 483 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 97.7
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 97.15
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 96.82
d1hkha_ 279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 96.8
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 96.67
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 96.12
d1wm1a_ 313 Proline aminopeptidase {Serratia marcescens [TaxId 96.01
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 95.94
d1a88a_ 275 Chloroperoxidase L {Streptomyces lividans [TaxId: 95.89
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 95.69
d1c4xa_ 281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 95.55
d2bgra2 258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 95.35
d1xfda2 258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 95.17
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 94.93
d2jbwa1 360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 94.9
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 94.89
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 94.85
d1pjaa_ 268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 94.31
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 94.09
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 93.91
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 93.84
d2rhwa1 283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 93.45
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 93.24
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 93.19
d1r3da_ 264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 92.76
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 92.71
d1j1ia_ 268 Meta cleavage compound hydrolase CarC {Janthinobac 92.57
d1uk8a_ 271 Meta-cleavage product hydrolase CumD {Pseudomonas 92.48
d1l7aa_ 318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 90.38
d1a8sa_ 273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 89.73
d2hu7a2 260 Acylamino-acid-releasing enzyme, C-terminal donain 89.52
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 89.21
d1qfma2 280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 87.66
d1ju3a2 347 Bacterial cocaine esterase N-terminal domain {Rhod 87.44
d3c70a1 256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 87.13
d1vlqa_ 322 Acetyl xylan esterase TM0077 {Thermotoga maritima 86.11
d1xkta_ 286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 85.06
d2b9va2 385 Alpha-amino acid ester hydrolase {Acetobacter past 84.77
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 84.45
d1tqha_ 242 Carboxylesterase Est {Bacillus stearothermophilus 84.31
d1qo7a_ 394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 82.66
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Serine carboxypeptidase-like
domain: Human 'protective protein', HPP
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=8.6e-56  Score=410.91  Aligned_cols=175  Identities=29%  Similarity=0.442  Sum_probs=157.0

Q ss_pred             cccCCccccCCCCCCCCCceeEEeEEEecCCCCceEEEEEEecCCCCCCCCceEeeCCCCcchhhhhhhhhhhCCeEEcC
Q 041087           60 LMQADKIKLLPGQSNGVDFDQYSGYVTVDPKSGRSLFYYFAESPQNSSTNPSLLWLDGGPGCSSLAYGAVTESGSFRMNK  139 (250)
Q Consensus        60 ~~~~d~V~~LPG~~~~v~~~~ysGyv~v~~~~~~~lFY~f~ea~~~~~~~PlvlWlNGGPGcSSl~~g~~~e~GP~~v~~  139 (250)
                      +++.|+|+.|||.+.++++++|||||+|++  +++|||||||++++|+++||+|||||||||||+ +|+|+|+|||+|+.
T Consensus         1 ~~~~~~v~~lPg~~~~~~~~~ysGyl~~~~--~~~lffw~~~s~~~~~~~Pl~~wlnGGPG~SS~-~g~~~e~GP~~v~~   77 (452)
T d1ivya_           1 APDQDEIQRLPGLAKQPSFRQYSGYLKSSG--SKHLHYWFVESQKDPENSPVVLWLNGGPGCSSL-DGLLTEHGPFLVQP   77 (452)
T ss_dssp             CCTTTBCSSCTTCSSCCSSCEEEEEEECST--TEEEEEEEECCSSCGGGSCEEEEECCTTTBCTH-HHHHTTTSSEEECT
T ss_pred             CCccCccccCcCcCCCCCccceeeeeecCC--CceEEEEEEEcCCCCCCCCEEEEECCCCcHHHH-HHHHHccCCcEEcC
Confidence            468899999999988899999999999985  689999999999999999999999999999999 79999999999999


Q ss_pred             CCCeeeecCCCCcCCCceeeeecCcccceeecccCCccccccchhhhhchHHHHHHHHHHHHHHHhcccccccccccccc
Q 041087          140 DGKTLFRNNYAWNNGDKTLRLGKRDILGIQRGWGFGTQVQLRTISLMVKNSMIKIHIPFLIKWLERNTKECSDSRDEAAD  219 (250)
Q Consensus       140 ~~~~l~~N~~SW~~~anlLfID~PvGtGfS~~~~~~~~~~~~~~~~~V~~~~a~~~~~fl~~fl~~~P~y~~~~l~i~gE  219 (250)
                      ++.++++|++||++.+||||||||+||||||..+..   ...+.     .+++++++.||++|+++||+|..+++||+||
T Consensus        78 ~~~~~~~N~~SW~~~anllfIDqPvGtGfS~~~~~~---~~~~~-----~~~a~d~~~~l~~f~~~fp~~~~~~~yi~GE  149 (452)
T d1ivya_          78 DGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKF---YATND-----TEVAQSNFEALQDFFRLFPEYKNNKLFLTGE  149 (452)
T ss_dssp             TSSCEEECTTCGGGSSEEEEECCSTTSTTCEESSCC---CCCBH-----HHHHHHHHHHHHHHHHHSGGGTTSCEEEEEE
T ss_pred             CCCeeccCCcchhcccCEEEEecCCCcccccCCCCC---CCCCc-----HHHHHHHHHHHHHHHHhchhhcCCceEEeec
Confidence            988999999999999999999999999999986321   11221     3678889999999999999999999999999


Q ss_pred             ccCCceecccccccccC-------CcccCCCCC
Q 041087          220 EIGDIDIYNICAPICIS-------PTFGNGSLG  245 (250)
Q Consensus       220 SYgG~~ip~ia~~~~~~-------~~~~~~~~~  245 (250)
                      ||||+|+|.||..+.+.       ..+|||.+.
T Consensus       150 SYgG~y~P~ia~~i~~~~~i~l~Gi~igng~~d  182 (452)
T d1ivya_         150 SYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSS  182 (452)
T ss_dssp             TTHHHHHHHHHHHHTTCTTSCEEEEEEESCCSB
T ss_pred             cccchhhHHHHHHHHhcCcccccceEcCCCccC
Confidence            99999999999887543       378888764
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure