Citrus Sinensis ID: 041164


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------
MEVAESKSKKAGGRLCSTCNQRKAALKRPKTLEQICRECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYRDDSLQTVKRNEIQYGLPLKIVSYKDLYGWTMDEIVKVIGLKNNCTFCGVFRRQALDRGASLLKVDKIATGHNADDIAETVLLNILRGDIARLSRCTLITTGEDGPIPRCKPFKYTYEKEIMFTYAYFKRLDYFSTECIYSPNAYRGFAREFIKDLERLRPRAILDIIKSGENFRISTSTKMPEQGTCERCGYISSQKWCKACVLLEGLNRGLPKMGIVRSRGQNNERTKDMKQNKGTKNIESKQCGTLDF
cccHHHHcccccccccccccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEEEEEccccccccHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHccHHHHccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccc
***************CSTCNQRKAALKRPKTLEQICRECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYRDDSLQTVKRNEIQYGLPLKIVSYKDLYGWTMDEIVKVIGLKNNCTFCGVFRRQALDRGASLLKVDKIATGHNADDIAETVLLNILRGDIARLSRCTLITTGEDGPIPRCKPFKYTYEKEIMFTYAYFKRLDYFSTECIYSPNAYRGFAREFIKDLERLRPRAILDIIKSGENFRISTS****EQGTCERCGYISSQKWCKACVLLEGLNRGLPKMGI*******************************DF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVAESKSKKAGGRLCSTCNQRKAALKRPKTLEQICRECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYRDDSLQTVKRNEIQYGLPLKIVSYKDLYGWTMDEIVKVIGLKNNCTFCGVFRRQALDRGASLLKVDKIATGHNADDIAETVLLNILRGDIARLSRCTLITTGEDGPIPRCKPFKYTYEKEIMFTYAYFKRLDYFSTECIYSPNAYRGFAREFIKDLERLRPRAILDIIKSGENFRISTSTKMPEQGTCERCGYISSQKWCKACVLLEGLNRGLPKMGIVRSRGQNNERTKDMKQNKGTKNIESKQCGTLDF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytoplasmic tRNA 2-thiolation protein 1 Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position.confidentO64862
Cytoplasmic tRNA 2-thiolation protein 1 Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated urm1 onto the uridine of tRNAs at wobble position.confidentQ5FW05
Cytoplasmic tRNA 2-thiolation protein 1 Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position.confidentQ6Z6G6

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WY5, chain A
Confidence level:very confident
Coverage over the Query: 39-283
View the alignment between query and template
View the model in PyMOL
Template: 2NZ2, chain A
Confidence level:confident
Coverage over the Query: 61-199,210-316
View the alignment between query and template
View the model in PyMOL
Template: 2WSI, chain A
Confidence level:confident
Coverage over the Query: 16-140,161-241
View the alignment between query and template
View the model in PyMOL