Citrus Sinensis ID: 041164

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------

MEVAESKSKKAGGRLCSTCNQRKAALKRPKTLEQICRECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYRDDSLQTVKRNEIQYGLPLKIVSYKDLYGWTMDEIVKVIGLKNNCTFCGVFRRQALDRGASLLKVDKIATGHNADDIAETVLLNILRGDIARLSRCTLITTGEDGPIPRCKPFKYTYEKEIMFTYAYFKRLDYFSTECIYSPNAYRGFAREFIKDLERLRPRAILDIIKSGENFRISTSTKMPEQGTCERCGYISSQKWCKACVLLEGLNRGLPKMGIVRSRGQNNERTKDMKQNKGTKNIESKQCGTLDF

ccHHHHHHccccccccccccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHccHHHHccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccc

ccccccccccccccHHHHcccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccHHHHHHHHHHHccccEEEEEHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHccHHHHHHcccccccccccccccccccHcHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccHHcccccccccccccccEcccccccHHHHHHHHHHHHHccccccEEEcccccccccccccccccccccccHHcccccccc

mevaeskskkaggrlcSTCNQRKAALKRPKTLEQICRECFYEVFEEEIHQVIVGNQLfkageriaigasggkdSTVLAFVLSELNRRHNYGLDLFLLSIDegisgyrddslqtVKRNEiqyglplkivSYKDLYGWTMDEIVKVIGlknnctfcgVFRRQALDRGAsllkvdkiatghnaddIAETVLLNILRGDIARLSRctlittgedgpiprckpfkytyEKEIMFTYAYFKRLDyfsteciyspnayRGFAREFIKDLERLRPRAILDIIKsgenfriststkmpeqgtcercgyissqkwCKACVLLEglnrglpkmgivrsrgqnnertkdmkqnkgtknieskqcgtldf

mevaeskskkaggrlcstcnqrkaalkrpktLEQICRECFYEVFEEEIHQVIVGNQLFKAGERIAigasggkdsTVLAFVLSELNRRHNYGLDLFLLSIDEGISGyrddslqtvkrneiqyglplkiVSYKDLYGWTMDEIVKVIGLKNNCTFCGVFRRQALDRGASLLKVDKiatghnaddiAETVLLNILRGDIARLSRCtlittgedgpiprckpFKYTYEKEIMFTYAYFKRLDYFSTECIYSPNAYRGFAREFIKDLERLRPRAILdiiksgenfriststkmpeqgtceRCGYISSQKWCKACVLLEglnrglpkmgivrsrgqnnertkdmkqnkgtknieskqcgtldf

*************************LKRPKTLEQICRECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYRDDSLQTVKRNEIQYGLPLKIVSYKDLYGWTMDEIVKVIGLKNNCTFCGVFRRQALDRGASLLKVDKIATGHNADDIAETVLLNILRGDIARLSRCTLITTGEDGPIPRCKPFKYTYEKEIMFTYAYFKRLDYFSTECIYSPNAYRGFAREFIKDLERLRPRAILDIIKSGENFRISTS****EQGTCERCGYISSQKWCKACVLLEGLNRGLPKMGI*********************************

***************CSTCNQRKAALKRPKTLEQICRECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYRDDSLQTVKRNEIQYGLPLKIVSYKDLYGWTMDEIVKVIGLKNNCTFCGVFRRQALDRGASLLKVDKIATGHNADDIAETVLLNILRGDIARLS*************PRCKPFKYTYEKEIMFTYAYFKRLDYFSTECIYSPNAYRGFAREFIKDLERLRPRAILDIIKSGENFR******************ISSQKWCKACVLL*******************************************DF

**************LCSTCNQRKAALKRPKTLEQICRECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYRDDSLQTVKRNEIQYGLPLKIVSYKDLYGWTMDEIVKVIGLKNNCTFCGVFRRQALDRGASLLKVDKIATGHNADDIAETVLLNILRGDIARLSRCTLITTGEDGPIPRCKPFKYTYEKEIMFTYAYFKRLDYFSTECIYSPNAYRGFAREFIKDLERLRPRAILDIIKSGENFRISTSTKMPEQGTCERCGYISSQKWCKACVLLEGLNRGLPKMGIVRSRGQNNERTKDMKQNKGTKNIESKQCGTLDF

************GRLCSTCNQRKAALKRPKTLEQICRECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYRDDSLQTVKRNEIQYGLPLKIVSYKDLYGWTMDEIVKVIGLKNNCTFCGVFRRQALDRGASLLKVDKIATGHNADDIAETVLLNILRGDIARLSRCTLITTGEDGPIPRCKPFKYTYEKEIMFTYAYFKRLDYFSTECIYSPNAYRGFAREFIKDLERLRPRAILDIIKSGENFRISTSTKMPEQGTCERCGYISSQKWCKACVLLEGLNRGLPKMGIV********************************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		357	2.2.26 [Sep-21-2011]
O64862		355	Cytoplasmic tRNA 2-thiola	yes	no	0.985	0.991	0.856	1e-179
Q6Z6G6		363	Cytoplasmic tRNA 2-thiola	yes	no	0.893	0.878	0.881	1e-168
A8JF71		357	Cytoplasmic tRNA 2-thiola	N/A	no	0.899	0.899	0.712	1e-139
Q5FW05		341	Cytoplasmic tRNA 2-thiola	yes	no	0.862	0.903	0.731	1e-137
Q05AW7		341	Cytoplasmic tRNA 2-thiola	N/A	no	0.862	0.903	0.731	1e-136
Q803X1		343	Cytoplasmic tRNA 2-thiola	yes	no	0.862	0.897	0.720	1e-134
Q94480		360	Cytoplasmic tRNA 2-thiola	yes	no	0.893	0.886	0.668	1e-127
B0DK66		354	Cytoplasmic tRNA 2-thiola	N/A	no	0.865	0.872	0.679	1e-124
Q7JWW5		343	Cytoplasmic tRNA 2-thiola	yes	no	0.871	0.906	0.678	1e-124
B4HSL7		343	Cytoplasmic tRNA 2-thiola	N/A	no	0.854	0.889	0.687	1e-123

>sp\|O64862\|CTU1_ARATH Cytoplasmic tRNA 2-thiolation protein 1 OS=Arabidopsis thaliana GN=NCS6 PE=2 SV=2	Back alignment and function desciption

 Score =  628 bits (1619), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 304/355 (85%), Positives = 330/355 (92%), Gaps = 3/355 (0%)

Query: 5   ESKSKKA-GGRLCSTCNQRKAALKRPKTLEQICRECFYEVFEEEIHQVIVGNQLFKAGER 63
           E+K+KKA   RLC  CN R+  LKRPKTL+QICRECFYEVFEEEIHQVIV N+LFK+GER
Sbjct: 2   EAKNKKAVASRLCCLCNLRRPVLKRPKTLQQICRECFYEVFEEEIHQVIVQNRLFKSGER 61

Query: 64  IAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYRDDSLQTVKRNEIQYGL 123
           +AIGASGGKDSTVLA+VLSELNRRHNYGLDLFLLSIDEGI+GYRDDSL+TVKRNE+QYGL
Sbjct: 62  VAIGASGGKDSTVLAYVLSELNRRHNYGLDLFLLSIDEGITGYRDDSLETVKRNEVQYGL 121

Query: 124 PLKIVSYKDLYGWTMDEIVKVIGLKNNCTFCGVFRRQALDRGASLLKVDKIATGHNADDI 183
           PLKIVSYKDLYGWTMDEIVK+IGLKNNCTFCGVFRRQALDRGA+LLKV+K+ TGHNADDI
Sbjct: 122 PLKIVSYKDLYGWTMDEIVKMIGLKNNCTFCGVFRRQALDRGAALLKVEKLVTGHNADDI 181

Query: 184 AETVLLNILRGDIARLSRCTLITTGEDGPIPRCKPFKYTYEKEIMFTYAYFKRLDYFSTE 243
           AETVLLNILRGDIARLSRCT ITTGEDGPIPRCKPFKYTYEKEI+  YAYFK+LDYFSTE
Sbjct: 182 AETVLLNILRGDIARLSRCTSITTGEDGPIPRCKPFKYTYEKEIVM-YAYFKKLDYFSTE 240

Query: 244 CIYSPNAYRGFAREFIKDLERLRPRAILDIIKSGENFRISTSTKMPEQGTCERCGYISSQ 303
           CIYSPNAYRGFAREFIKDLER+RPRAILDIIKSGE+FRI+T+TKMPEQGTCERCGYISSQ
Sbjct: 241 CIYSPNAYRGFAREFIKDLERIRPRAILDIIKSGEDFRIATTTKMPEQGTCERCGYISSQ 300

Query: 304 KWCKACVLLEGLNRGLPKMGIVRSRGQNNERTKDMKQNKGT-KNIESKQCGTLDF 357
           KWCKACVLLEGLNRGLPKMGI R RG N +  K+ K+     K+IESKQCG+LDF
Sbjct: 301 KWCKACVLLEGLNRGLPKMGIGRPRGVNGDHNKETKKPGSVAKSIESKQCGSLDF 355

Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: -

>sp\|Q6Z6G6\|CTU1_ORYSJ Cytoplasmic tRNA 2-thiolation protein 1 OS=Oryza sativa subsp. japonica GN=NCS6 PE=2 SV=1	Back alignment and function description

>sp\|A8JF71\|CTU1_CHLRE Cytoplasmic tRNA 2-thiolation protein 1 OS=Chlamydomonas reinhardtii GN=NCS6 PE=3 SV=1	Back alignment and function description

>sp\|Q5FW05\|CTU1_XENTR Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus tropicalis GN=ctu1 PE=2 SV=1	Back alignment and function description

>sp\|Q05AW7\|CTU1_XENLA Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus laevis GN=ctu1 PE=2 SV=1	Back alignment and function description

>sp\|Q803X1\|CTU1_DANRE Cytoplasmic tRNA 2-thiolation protein 1 OS=Danio rerio GN=ctu1 PE=2 SV=1	Back alignment and function description

>sp\|Q94480\|CTU1_DICDI Cytoplasmic tRNA 2-thiolation protein 1 OS=Dictyostelium discoideum GN=ctu1 PE=2 SV=2	Back alignment and function description

>sp\|B0DK66\|CTU1_LACBS Cytoplasmic tRNA 2-thiolation protein 1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=NCS6 PE=3 SV=1	Back alignment and function description

>sp\|Q7JWW5\|CTU1_DROME Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila melanogaster GN=CG8078 PE=1 SV=1	Back alignment and function description

>sp\|B4HSL7\|CTU1_DROSE Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila sechellia GN=GM20632 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		357
224083793		354	predicted protein [Populus trichocarpa]	0.977	0.985	0.911	0.0
255539134		361	cancer-associatedprotein protein, putati	1.0	0.988	0.869	0.0
359492862		363	PREDICTED: cytoplasmic tRNA 2-thiolation	1.0	0.983	0.859	0.0
449450470		359	PREDICTED: cytoplasmic tRNA 2-thiolation	1.0	0.994	0.860	0.0
225459814		356	PREDICTED: cytoplasmic tRNA 2-thiolation	0.997	1.0	0.871	0.0
302141685		370	unnamed protein product [Vitis vinifera]	1.0	0.964	0.843	0.0
297828145		355	hypothetical protein ARALYDRAFT_483552 [	0.985	0.991	0.856	1e-177
145360979		355	cytoplasmic tRNA 2-thiolation protein 1	0.985	0.991	0.856	1e-177
3128173		358	hypothetical protein [Arabidopsis thalia	0.988	0.986	0.837	1e-173
363814272		353	uncharacterized protein LOC100816096 [Gl	0.983	0.994	0.813	1e-169

>gi\|224083793\|ref\|XP_002307125.1\| predicted protein [Populus trichocarpa] gi\|222856574\|gb\|EEE94121.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/349 (91%), Positives = 334/349 (95%)

Query: 9   KKAGGRLCSTCNQRKAALKRPKTLEQICRECFYEVFEEEIHQVIVGNQLFKAGERIAIGA 68
           KKA GRLC  CNQR+AALKRPKTLEQICRECFYEVFEEEIHQVIV NQLFK GERIAIGA
Sbjct: 6   KKAAGRLCYLCNQRRAALKRPKTLEQICRECFYEVFEEEIHQVIVKNQLFKPGERIAIGA 65

Query: 69  SGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYRDDSLQTVKRNEIQYGLPLKIV 128
           SGGKDSTVLA+VLSELNRRHNYGLDLFLLS+DEGI+GYRDDSL+TVKRNEIQYGLPLKIV
Sbjct: 66  SGGKDSTVLAYVLSELNRRHNYGLDLFLLSVDEGITGYRDDSLETVKRNEIQYGLPLKIV 125

Query: 129 SYKDLYGWTMDEIVKVIGLKNNCTFCGVFRRQALDRGASLLKVDKIATGHNADDIAETVL 188
           SYKDLYGWTMDEIVK+IGLKNNCTFCGVFRRQALDRGA+LLKVDK+ TGHNADDIAETVL
Sbjct: 126 SYKDLYGWTMDEIVKMIGLKNNCTFCGVFRRQALDRGAALLKVDKLVTGHNADDIAETVL 185

Query: 189 LNILRGDIARLSRCTLITTGEDGPIPRCKPFKYTYEKEIMFTYAYFKRLDYFSTECIYSP 248
           LNILRGDIARLSRCT ITTGEDGPIPRCKPFKYTYEKEIM TYAYFKRLDYFSTECIYSP
Sbjct: 186 LNILRGDIARLSRCTSITTGEDGPIPRCKPFKYTYEKEIMLTYAYFKRLDYFSTECIYSP 245

Query: 249 NAYRGFAREFIKDLERLRPRAILDIIKSGENFRISTSTKMPEQGTCERCGYISSQKWCKA 308
           NAYRGFAREFIKDLER+RPRAILDIIKSGE+FRISTSTKMPEQGTCERCGYISSQKWCKA
Sbjct: 246 NAYRGFAREFIKDLERMRPRAILDIIKSGEDFRISTSTKMPEQGTCERCGYISSQKWCKA 305

Query: 309 CVLLEGLNRGLPKMGIVRSRGQNNERTKDMKQNKGTKNIESKQCGTLDF 357
           CVLLEGLN+GLPK+GI RSRG +N   KD+KQ+ GTKNIE KQCG+LDF
Sbjct: 306 CVLLEGLNKGLPKLGIGRSRGLDNNHRKDVKQSNGTKNIEGKQCGSLDF 354

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255539134\|ref\|XP_002510632.1\| cancer-associatedprotein protein, putative [Ricinus communis] gi\|223551333\|gb\|EEF52819.1\| cancer-associatedprotein protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|359492862\|ref\|XP_003634474.1\| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like isoform 2 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449450470\|ref\|XP_004142985.1\| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Cucumis sativus] gi\|449529421\|ref\|XP_004171698.1\| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|225459814\|ref\|XP_002285915.1\| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like isoform 1 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|302141685\|emb\|CBI18888.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297828145\|ref\|XP_002881955.1\| hypothetical protein ARALYDRAFT_483552 [Arabidopsis lyrata subsp. lyrata] gi\|297327794\|gb\|EFH58214.1\| hypothetical protein ARALYDRAFT_483552 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi|145360979|ref|NP_181956.2| cytoplasmic tRNA 2-thiolation protein 1 [Arabidopsis thaliana] gi|226711456|sp|O64862.2|CTU1_ARATH RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; AltName: Full=Cytoplasmic tRNA adenylyltransferase 1 gi|26449617|dbj|BAC41934.1| unknown protein [Arabidopsis thaliana] gi|30725380|gb|AAP37712.1| At2g44270 [Arabidopsis thaliana] gi|330255305|gb|AEC10399.1| cytoplasmic tRNA 2-thiolation protein 1 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|3128173\|gb\|AAC16077.1\| hypothetical protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|363814272\|ref\|NP_001242776.1\| uncharacterized protein LOC100816096 [Glycine max] gi\|255635229\|gb\|ACU17969.1\| unknown [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		357
TAIR\|locus:2199772		332	AT1G76170 [Arabidopsis thalian	0.893	0.960	0.875	3.9e-155
UNIPROTKB\|Q5FW05		341	ctu1 "Cytoplasmic tRNA 2-thiol	0.943	0.988	0.672	2.6e-125
UNIPROTKB\|Q05AW7		341	ctu1 "Cytoplasmic tRNA 2-thiol	0.862	0.903	0.731	1.5e-124
ZFIN\|ZDB-GENE-040426-704		343	ctu1 "cytosolic thiouridylase	0.941	0.979	0.669	1.2e-122
DICTYBASE\|DDB_G0282921		360	ctu1 "cytosolic thiouridylase	0.977	0.969	0.633	2e-120
UNIPROTKB\|A8PVM6		373	NCS6 "Cytoplasmic tRNA 2-thiol	0.554	0.530	0.698	4.2e-117
FB\|FBgn0033375		343	CG8078 [Drosophila melanogaste	0.876	0.912	0.675	3.5e-114
UNIPROTKB\|B4HSL7		343	GM20632 "Cytoplasmic tRNA 2-th	0.876	0.912	0.671	5.8e-114
UNIPROTKB\|B0DK66		354	NCS6 "Cytoplasmic tRNA 2-thiol	0.871	0.878	0.684	9.4e-114
UNIPROTKB\|B3N7L9		343	GG10584 "Cytoplasmic tRNA 2-th	0.896	0.932	0.659	1.9e-113

TAIR\|locus:2199772 AT1G76170 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1484 (527.5 bits), Expect = 3.9e-155, Sum P(2) = 3.9e-155
 Identities = 280/320 (87%), Positives = 300/320 (93%)

Query:    38 ECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLL 97
             ECFYEVFEEEIHQVIVGN+LFK GER+AIGASGGKDS+VLA+VLSELNRRH+YGLDLFLL
Sbjct:    14 ECFYEVFEEEIHQVIVGNRLFKFGERVAIGASGGKDSSVLAYVLSELNRRHSYGLDLFLL 73

Query:    98 SIDEGISGYRDDSLQTVKRNEIQYGLPLKIVSYKDLYGWTMDEIVKVIGLKNNCTFCGVF 157
             SIDEGI+GYRDDSL+TVKRNE+QYGLPL+IVSYKDLYGWTMDEIVK+IGLKNNCTFCGVF
Sbjct:    74 SIDEGITGYRDDSLETVKRNEVQYGLPLQIVSYKDLYGWTMDEIVKMIGLKNNCTFCGVF 133

Query:   158 RRQALDRGASLLKVDKIATGHNADDIAETVLLNILRGDIARLSRCTLITTGEDGPIPRCK 217
             RRQALDRGA+LLKVDK+ TGHNADDIAETV+LNILRGDIARLSRCT ITTGEDGPIPRCK
Sbjct:   134 RRQALDRGAALLKVDKLVTGHNADDIAETVVLNILRGDIARLSRCTSITTGEDGPIPRCK 193

Query:   218 PFKYTYEKEIMFTYAYFKRLDYFSTECIYSPNAYRGFAREFIKDLERLRPRAILDIIKSG 277
             PFKYTYEKEI+  YAYFK+LDYFSTECIYSPNAYRGFA EFI DLERLRPRAILDIIKSG
Sbjct:   194 PFKYTYEKEIVM-YAYFKKLDYFSTECIYSPNAYRGFACEFINDLERLRPRAILDIIKSG 252

Query:   278 ENFRISTSTKMPEQGTCERCGYISSQKWCKACVLLEGLNRGLPKMGIVRSRGQNNERTKD 337
             E+FRI+T+TKMPEQGTCERCGYISSQKWCKACVLLEGLNRGLPKMGI R RG  N   KD
Sbjct:   253 EDFRIATTTKMPEQGTCERCGYISSQKWCKACVLLEGLNRGLPKMGIGRPRGNVNGDYKD 312

Query:   338 MKQNKGTKNIESKQCGTLDF 357
             +K     K IESKQCG+LDF
Sbjct:   313 IKARSTAKTIESKQCGSLDF 332

GO:0000049 "tRNA binding" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005737 "cytoplasm" evidence=ISM;IEA

GO:0008033 "tRNA processing" evidence=IEA

GO:0034227 "tRNA thio-modification" evidence=IEA

UNIPROTKB\|Q5FW05 ctu1 "Cytoplasmic tRNA 2-thiolation protein 1" [Xenopus (Silurana) tropicalis (taxid:8364)]	Back alignment and assigned GO terms

UNIPROTKB\|Q05AW7 ctu1 "Cytoplasmic tRNA 2-thiolation protein 1" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-704 ctu1 "cytosolic thiouridylase subunit 1 homolog (S. pombe)" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0282921 ctu1 "cytosolic thiouridylase subunit 1" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|A8PVM6 NCS6 "Cytoplasmic tRNA 2-thiolation protein 1" [Malassezia globosa CBS 7966 (taxid:425265)]	Back alignment and assigned GO terms

FB\|FBgn0033375 CG8078 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|B4HSL7 GM20632 "Cytoplasmic tRNA 2-thiolation protein 1" [Drosophila sechellia (taxid:7238)]	Back alignment and assigned GO terms

UNIPROTKB\|B0DK66 NCS6 "Cytoplasmic tRNA 2-thiolation protein 1" [Laccaria bicolor S238N-H82 (taxid:486041)]	Back alignment and assigned GO terms

UNIPROTKB\|B3N7L9 GG10584 "Cytoplasmic tRNA 2-thiolation protein 1" [Drosophila erecta (taxid:7220)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q58558	Y1157_METJA	No assigned EC number	0.3387	0.8039	0.8416	yes	no
Q94480	CTU1_DICDI	2, ., 7, ., 7, ., -	0.6687	0.8935	0.8861	yes	no
B4J5B3	CTU1_DROGR	2, ., 7, ., 7, ., -	0.6940	0.8403	0.8746	N/A	no
O76365	CTU1_CAEEL	2, ., 7, ., 7, ., -	0.6245	0.8403	0.8042	yes	no
B4P3W7	CTU1_DROYA	2, ., 7, ., 7, ., -	0.6750	0.8711	0.9067	N/A	no
B4NN33	CTU1_DROWI	2, ., 7, ., 7, ., -	0.6838	0.8543	0.8892	N/A	no
A5DPQ4	CTU1_PICGU	2, ., 7, ., 7, ., -	0.5840	0.8655	0.8373	N/A	no
Q7Z7A3	CTU1_HUMAN	2, ., 7, ., 7, ., -	0.4376	0.9271	0.9511	yes	no
P0CS71	CTU1_CRYNB	2, ., 7, ., 7, ., -	0.6708	0.8739	0.8595	N/A	no
P0CS70	CTU1_CRYNJ	2, ., 7, ., 7, ., -	0.6708	0.8739	0.8595	yes	no
Q4P6R3	CTU1_USTMA	2, ., 7, ., 7, ., -	0.6118	0.8963	0.8080	N/A	no
B4LM02	CTU1_DROVI	2, ., 7, ., 7, ., -	0.6699	0.8571	0.8921	N/A	no
Q5FW05	CTU1_XENTR	2, ., 7, ., 7, ., -	0.7313	0.8627	0.9032	yes	no
B4KLL0	CTU1_DROMO	2, ., 7, ., 7, ., -	0.6806	0.8543	0.8892	N/A	no
P53088	CTU1_YEAST	2, ., 7, ., 7, ., -	0.5875	0.8683	0.8635	yes	no
Q6Z6G6	CTU1_ORYSJ	2, ., 7, ., 7, ., -	0.8812	0.8935	0.8787	yes	no
B4GHY8	CTU1_DROPE	2, ., 7, ., 7, ., -	0.6819	0.8431	0.8775	N/A	no
Q05AW7	CTU1_XENLA	2, ., 7, ., 7, ., -	0.7313	0.8627	0.9032	N/A	no
B1WBV0	CTU1_RAT	2, ., 7, ., 7, ., -	0.4764	0.8683	0.8115	yes	no
Q6FMB5	CTU1_CANGA	2, ., 7, ., 7, ., -	0.6187	0.8711	0.8687	yes	no
B4HSL7	CTU1_DROSE	2, ., 7, ., 7, ., -	0.6870	0.8543	0.8892	N/A	no
Q6CWX6	CTU1_KLULA	2, ., 7, ., 7, ., -	0.5910	0.8711	0.8382	yes	no
A8WR63	CTU1_CAEBR	2, ., 7, ., 7, ., -	0.6262	0.8515	0.8172	N/A	no
Q0VC66	CTU1_BOVIN	2, ., 7, ., 7, ., -	0.4639	0.8683	0.8933	yes	no
A7TER7	CTU1_VANPO	2, ., 7, ., 7, ., -	0.5975	0.8627	0.8484	N/A	no
Q803X1	CTU1_DANRE	2, ., 7, ., 7, ., -	0.7202	0.8627	0.8979	yes	no
A8JF71	CTU1_CHLRE	2, ., 7, ., 7, ., -	0.7129	0.8991	0.8991	N/A	no
A8PVM6	CTU1_MALGO	2, ., 7, ., 7, ., -	0.6379	0.8627	0.8257	N/A	no
Q6C8R5	CTU1_YARLI	2, ., 7, ., 7, ., -	0.5830	0.8655	0.8465	yes	no
B5RV24	CTU1_DEBHA	2, ., 7, ., 7, ., -	0.5497	0.8655	0.8196	yes	no
A2Q879	CTU1_ASPNC	2, ., 7, ., 7, ., -	0.6199	0.8935	0.9354	yes	no
Q755T1	CTU1_ASHGO	2, ., 7, ., 7, ., -	0.5772	0.8879	0.8498	yes	no
A6ZTX8	CTU1_YEAS7	2, ., 7, ., 7, ., -	0.5856	0.8711	0.8662	N/A	no
Q7Q9I4	CTU1_ANOGA	2, ., 7, ., 7, ., -	0.6446	0.8795	0.9181	yes	no
O94282	CTU1_SCHPO	2, ., 7, ., 7, ., -	0.6426	0.8795	0.9373	yes	no
B0DK66	CTU1_LACBS	2, ., 7, ., 7, ., -	0.6794	0.8655	0.8728	N/A	no
Q16QI1	CTU1_AEDAE	2, ., 7, ., 7, ., -	0.6583	0.8851	0.9266	N/A	no
O64862	CTU1_ARATH	2, ., 7, ., 7, ., -	0.8563	0.9859	0.9915	yes	no
B3MI77	CTU1_DROAN	2, ., 7, ., 7, ., -	0.6838	0.8543	0.8892	N/A	no
Q28ZC1	CTU1_DROPS	2, ., 7, ., 7, ., -	0.6819	0.8431	0.8775	yes	no
B3LHQ7	CTU1_YEAS1	2, ., 7, ., 7, ., -	0.5856	0.8711	0.8662	N/A	no
A3GGB3	CTU1_PICST	2, ., 7, ., 7, ., -	0.5449	0.8963	0.8510	yes	no
Q7JWW5	CTU1_DROME	2, ., 7, ., 7, ., -	0.6782	0.8711	0.9067	yes	no
B3N7L9	CTU1_DROER	2, ., 7, ., 7, ., -	0.6750	0.8711	0.9067	N/A	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.7.7	0.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		357
cd01993		185	cd01993, Alpha_ANH_like_II, This is a subfamily of	4e-86
COG0037		298	COG0037, MesJ, tRNA(Ile)-lysidine synthase MesJ [C	1e-59
cd01992		185	cd01992, PP-ATPase, N-terminal domain of predicted	4e-19
PRK10696		258	PRK10696, PRK10696, tRNA 2-thiocytidine biosynthes	6e-17
TIGR00269		104	TIGR00269, TIGR00269, TIGR00269 family protein	2e-15
TIGR02432		189	TIGR02432, lysidine_TilS_N, tRNA(Ile)-lysidine syn	5e-15
pfam01171		182	pfam01171, ATP_bind_3, PP-loop family	4e-14
cd01986		103	cd01986, Alpha_ANH_like, Adenine nucleotide alpha	4e-07
COG1606		269	COG1606, COG1606, ATP-utilizing enzymes of the PP-	3e-05
cd01998		349	cd01998, tRNA_Me_trans, tRNA methyl transferase	2e-04
pfam03054		355	pfam03054, tRNA_Me_trans, tRNA methyl transferase	2e-04
cd01713		173	cd01713, PAPS_reductase, This domain is found in p	6e-04
cd01990		202	cd01990, Alpha_ANH_like_I, This is a subfamily of	0.001
cd01984		86	cd01984, AANH_like, Adenine nucleotide alpha hydro	0.002
TIGR00268		252	TIGR00268, TIGR00268, TIGR00268 family protein	0.004

>gnl\|CDD\|238951 cd01993, Alpha_ANH_like_II, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily	Back alignment and domain information

 Score =  257 bits (659), Expect = 4e-86
 Identities = 91/188 (48%), Positives = 120/188 (63%), Gaps = 3/188 (1%)

Query: 63  RIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYRDDSLQTVKRNEIQYG 122
           RI +  SGGKDS VL  VL +L RR+ YG +L  L++DEGI GYRD+SL+ V+R   + G
Sbjct: 1   RILVALSGGKDSLVLLHVLKKLQRRYPYGFELEALTVDEGIPGYRDESLEVVERLAEELG 60

Query: 123 LPLKIVSYKDLYGWTMDEIVKVIGLKNNCTFCGVFRRQALDRGASLLKVDKIATGHNADD 182
           + L+IVS+K+ Y  T D  VK  G K+ C+ CGV RR  L++ A  L  DK+ATGHN DD
Sbjct: 61  IELEIVSFKEEY--TDDIEVKKRGGKSPCSLCGVLRRGLLNKIAKELGADKLATGHNLDD 118

Query: 183 IAETVLLNILRGDIARLSRCTLITTGEDGPIPRCKPFKYTYEKEIMFTYAYFKRLDYFST 242
            AET+L+N+LRG I RL R   I   ++G + R +P  Y  EKEI+  YA    L +   
Sbjct: 119 EAETLLMNLLRGGILRLMRPGPILYLDEGDVTRIRPLVYVREKEIV-LYAELNGLPFVEE 177

Query: 243 ECIYSPNA 250
           EC Y+ NA
Sbjct: 178 ECPYAGNA 185

Adeninosine nucleotide alpha hydrolases superfamily includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which binds to Adenosine group. This subfamily of proteins is predicted to bind ATP. This domainhas a strongly conserved motif SGGKD at the N terminus. Length = 185

>gnl\|CDD\|223115 COG0037, MesJ, tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|238950 cd01992, PP-ATPase, N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|236737 PRK10696, PRK10696, tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional	Back alignment and domain information

>gnl\|CDD\|129370 TIGR00269, TIGR00269, TIGR00269 family protein	Back alignment and domain information

>gnl\|CDD\|233864 TIGR02432, lysidine_TilS_N, tRNA(Ile)-lysidine synthetase, N-terminal domain	Back alignment and domain information

>gnl\|CDD\|216343 pfam01171, ATP_bind_3, PP-loop family	Back alignment and domain information

>gnl\|CDD\|238944 cd01986, Alpha_ANH_like, Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases	Back alignment and domain information

>gnl\|CDD\|224522 COG1606, COG1606, ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|238956 cd01998, tRNA_Me_trans, tRNA methyl transferase	Back alignment and domain information

>gnl\|CDD\|217339 pfam03054, tRNA_Me_trans, tRNA methyl transferase	Back alignment and domain information

>gnl\|CDD\|238846 cd01713, PAPS_reductase, This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase	Back alignment and domain information

>gnl\|CDD\|238948 cd01990, Alpha_ANH_like_I, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily	Back alignment and domain information

>gnl\|CDD\|238942 cd01984, AANH_like, Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF)	Back alignment and domain information

>gnl\|CDD\|129369 TIGR00268, TIGR00268, TIGR00268 family protein	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		357
KOG2840		347	consensus Uncharacterized conserved protein with s	100.0
PRK10696		258	tRNA 2-thiocytidine biosynthesis protein TtcA; Pro	100.0
COG0037		298	MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle	100.0
PF01171		182	ATP_bind_3: PP-loop family; InterPro: IPR011063 Th	100.0
PRK10660		436	tilS tRNA(Ile)-lysidine synthetase; Provisional	100.0
cd01993		185	Alpha_ANH_like_II This is a subfamily of Adenine n	100.0
TIGR02432		189	lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t	100.0
cd01992		185	PP-ATPase N-terminal domain of predicted ATPase of	100.0
KOG2594		396	consensus Uncharacterized conserved protein [Funct	99.97
PRK08349		198	hypothetical protein; Validated	99.96
PRK00143		346	mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed	99.96
PRK14665		360	mnmA tRNA-specific 2-thiouridylase MnmA; Provision	99.93
cd01998		349	tRNA_Me_trans tRNA methyl transferase. This family	99.93
cd01712		177	ThiI ThiI is required for thiazole synthesis in th	99.92
cd01997		295	GMP_synthase_C The C-terminal domain of GMP synthe	99.92
PRK00074		511	guaA GMP synthase; Reviewed	99.91
TIGR00420		352	trmU tRNA (5-methylaminomethyl-2-thiouridylate)-me	99.91
TIGR00884		311	guaA_Cterm GMP synthase (glutamine-hydrolyzing), C	99.91
cd01990		202	Alpha_ANH_like_I This is a subfamily of Adenine nu	99.91
PRK14664		362	tRNA-specific 2-thiouridylase MnmA; Provisional	99.91
TIGR00268		252	conserved hypothetical protein TIGR00268. The N-te	99.9
PRK00919		307	GMP synthase subunit B; Validated	99.9
PRK08384		381	thiamine biosynthesis protein ThiI; Provisional	99.88
PRK13820		394	argininosuccinate synthase; Provisional	99.88
PRK01269		482	tRNA s(4)U8 sulfurtransferase; Provisional	99.88
PRK14561		194	hypothetical protein; Provisional	99.87
PF03054		356	tRNA_Me_trans: tRNA methyl transferase; InterPro:	99.87
PRK05253		301	sulfate adenylyltransferase subunit 2; Provisional	99.87
TIGR00269		104	conserved hypothetical protein TIGR00269.	99.87
TIGR00342		371	thiazole biosynthesis/tRNA modification protein Th	99.87
cd01713		173	PAPS_reductase This domain is found in phosphoaden	99.87
PRK08576		438	hypothetical protein; Provisional	99.86
COG0482		356	TrmU Predicted tRNA(5-methylaminomethyl-2-thiourid	99.86
TIGR00552		250	nadE NAD+ synthetase. NAD+ synthetase is a nearly	99.85
PRK00509		399	argininosuccinate synthase; Provisional	99.84
COG1606		269	ATP-utilizing enzymes of the PP-loop superfamily [	99.83
TIGR02039		294	CysD sulfate adenylyltransferase, small subunit. I	99.83
TIGR00364		201	exsB protein. This protein family is represented b	99.83
cd01999		385	Argininosuccinate_Synthase Argininosuccinate synth	99.81
PRK02090		241	phosphoadenosine phosphosulfate reductase; Provisi	99.81
TIGR00032		394	argG argininosuccinate synthase. argG in bacteria,	99.81
cd01995		169	ExsB ExsB is a transcription regulator related pro	99.8
PRK11106		231	queuosine biosynthesis protein QueC; Provisional	99.8
PRK01565		394	thiamine biosynthesis protein ThiI; Provisional	99.79
PLN00200		404	argininosuccinate synthase; Provisional	99.79
PRK04527		400	argininosuccinate synthase; Provisional	99.77
TIGR03573		343	WbuX N-acetyl sugar amidotransferase. This enzyme	99.77
PF02568		197	ThiI: Thiamine biosynthesis protein (ThiI); InterP	99.76
PRK12563		312	sulfate adenylyltransferase subunit 2; Provisional	99.75
cd00553		248	NAD_synthase NAD+ synthase is a homodimer, which c	99.75
PF06508		209	QueC: Queuosine biosynthesis protein QueC; InterPr	99.74
cd01986		103	Alpha_ANH_like Adenine nucleotide alpha hydrolases	99.73
PRK13980		265	NAD synthetase; Provisional	99.73
PLN02347		536	GMP synthetase	99.69
COG0603		222	Predicted PP-loop superfamily ATPase [General func	99.68
KOG2805		377	consensus tRNA (5-methylaminomethyl-2-thiouridylat	99.67
cd01996		154	Alpha_ANH_like_III This is a subfamily of Adenine	99.67
COG0519		315	GuaA GMP synthase, PP-ATPase domain/subunit [Nucle	99.61
PRK08557		417	hypothetical protein; Provisional	99.59
PRK05370		447	argininosuccinate synthase; Validated	99.59
PRK13795		636	hypothetical protein; Provisional	99.57
PF01507		174	PAPS_reduct: Phosphoadenosine phosphosulfate reduc	99.57
PRK13794		479	hypothetical protein; Provisional	99.56
TIGR00434		212	cysH phosophoadenylyl-sulfate reductase (thioredox	99.55
TIGR02057		226	PAPS_reductase phosphoadenosine phosphosulfate red	99.55
PF02540		242	NAD_synthase: NAD synthase; InterPro: IPR022310 NA	99.53
COG0301		383	ThiI Thiamine biosynthesis ATP pyrophosphatase [Co	99.52
COG0137		403	ArgG Argininosuccinate synthase [Amino acid transp	99.51
cd01994		194	Alpha_ANH_like_IV This is a subfamily of Adenine n	99.5
PF00764		388	Arginosuc_synth: Arginosuccinate synthase; InterPr	99.5
PRK02628		679	nadE NAD synthetase; Reviewed	99.46
COG0175		261	CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotr	99.46
PTZ00323		294	NAD+ synthase; Provisional	99.41
TIGR03679		218	arCOG00187 arCOG00187 universal archaeal metal-bin	99.37
PRK00876		326	nadE NAD synthetase; Reviewed	99.35
PF10288		107	DUF2392: Protein of unknown function (DUF2392); In	99.35
COG2117		198	Predicted subunit of tRNA(5-methylaminomethyl-2-th	99.3
PRK00768		268	nadE NAD synthetase; Reviewed	99.21
PRK13981		540	NAD synthetase; Provisional	99.19
cd01984		86	AANH_like Adenine nucleotide alpha hydrolases supe	99.13
TIGR03183		447	DNA_S_dndC putative sulfurtransferase DndC. Member	99.12
COG1365		255	Predicted ATPase (PP-loop superfamily) [General fu	99.1
cd01991		269	Asn_Synthase_B_C The C-terminal domain of Asparagi	99.09
COG0171		268	NadE NAD synthase [Coenzyme metabolism]	99.07
PRK06850		507	hypothetical protein; Provisional	99.06
PF00733		255	Asn_synthase: Asparagine synthase; InterPro: IPR00	99.03
TIGR02055		191	APS_reductase thioredoxin-dependent adenylylsulfat	99.01
TIGR01536		467	asn_synth_AEB asparagine synthase (glutamine-hydro	99.0
TIGR00424		463	APS_reduc 5'-adenylylsulfate reductase, thioredoxi	99.0
PLN02309		457	5'-adenylylsulfate reductase	99.0
KOG1706		412	consensus Argininosuccinate synthase [Amino acid t	98.98
KOG1622		552	consensus GMP synthase [Nucleotide transport and m	98.97
TIGR00289		222	conserved hypothetical protein TIGR00289. Homologo	98.83
COG3969		407	Predicted phosphoadenosine phosphosulfate sulfotra	98.61
TIGR00290		223	MJ0570_dom MJ0570-related uncharacterized domain.	98.58
COG2102		223	Predicted ATPases of PP-loop superfamily [General	98.49
PF01902		218	ATP_bind_4: ATP-binding region; InterPro: IPR00276	98.49
PLN02549		578	asparagine synthase (glutamine-hydrolyzing)	98.46
PTZ00077		586	asparagine synthetase-like protein; Provisional	98.4
PRK09431		554	asnB asparagine synthetase B; Provisional	98.35
TIGR03108		628	eps_aminotran_1 exosortase 1 system-associated ami	98.21
PLN02339		700	NAD+ synthase (glutamine-hydrolysing)	98.14
TIGR03104		589	trio_amidotrans asparagine synthase family amidotr	98.12
COG0367		542	AsnB Asparagine synthase (glutamine-hydrolyzing) [	98.05
KOG0571		543	consensus Asparagine synthase (glutamine-hydrolyzi	97.67
PF02677		176	DUF208: Uncharacterized BCR, COG1636; InterPro: IP	97.44
COG1636		204	Uncharacterized protein conserved in bacteria [Fun	97.0
cd01987		124	USP_OKCHK USP domain is located between the N-term	96.85
KOG0189		261	consensus Phosphoadenosine phosphosulfate reductas	96.82
cd01988		132	Na_H_Antiporter_C The C-terminal domain of a subfa	96.13
PRK10490		895	sensor protein KdpD; Provisional	95.89
KOG2316		277	consensus Predicted ATPase (PP-loop superfamily) [	95.85
cd00293		130	USP_Like Usp: Universal stress protein family. The	95.73
COG2205		890	KdpD Osmosensitive K+ channel histidine kinase [Si	95.67
PRK09982		142	universal stress protein UspD; Provisional	95.49
PRK15118		144	universal stress global response regulator UspA; P	95.08
cd01989		146	STK_N The N-terminal domain of Eukaryotic Serine T	95.02
cd05565		99	PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of en	94.94
PRK10116		142	universal stress protein UspC; Provisional	93.94
KOG0573		520	consensus Asparagine synthase [Amino acid transpor	93.34
PRK15005		144	universal stress protein F; Provisional	92.92
TIGR00853		95	pts-lac PTS system, lactose/cellobiose family IIB	91.42
PF00582		140	Usp: Universal stress protein family; InterPro: IP	91.1
PRK15456		142	universal stress protein UspG; Provisional	90.73
PRK09590		104	celB cellobiose phosphotransferase system IIB comp	90.44
COG1440		102	CelA Phosphotransferase system cellobiose-specific	89.18
cd05564		96	PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lic	88.5
PTZ00218		54	40S ribosomal protein S29; Provisional	87.98
PF02132		41	RecR: RecR protein; InterPro: IPR023628 The bacter	87.05
KOG2303		706	consensus Predicted NAD synthase, contains CN hydr	85.33
PRK12652		357	putative monovalent cation/H+ antiporter subunit E	85.1
PRK11175		305	universal stress protein UspE; Provisional	85.08
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	84.48
COG0788		287	PurU Formyltetrahydrofolate hydrolase [Nucleotide	83.99
KOG3425		128	consensus Uncharacterized conserved protein [Funct	83.58
PRK11175		305	universal stress protein UspE; Provisional	82.24
PRK13010		289	purU formyltetrahydrofolate deformylase; Reviewed	81.77

>KOG2840 consensus Uncharacterized conserved protein with similarity to predicted ATPase of the PP-loop superfamily [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=5.5e-47  Score=345.03  Aligned_cols=314  Identities=63%  Similarity=1.055  Sum_probs=292.6

Q ss_pred             cccccccCCCceeeccCCCccchHHHHHHHHHHHHHHHHhhcCCCCCCCEEEEEecCChhHHHHHHHHHHHhhhCCCCee
Q 041164           14 RLCSTCNQRKAALKRPKTLEQICRECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLD   93 (357)
Q Consensus        14 ~~C~~C~~~~a~~~~~~~~~~lC~~cf~~~~~~kv~~~i~k~~l~~~~~kvlVa~SGG~DS~~LL~ll~~~~~~~~~g~~   93 (357)
                      +.|..|..+.+.+..++.+..+|+.||+..|+..|..++-+.+++..|++|.++-|||+||+++++++..+..++.+|.+
T Consensus         4 ~~~~~~~~~~~~i~rp~~~q~~c~~cf~~~fe~e~~~ti~~n~l~~rge~v~igasGgkdstvlA~v~~~Ln~r~~~g~~   83 (347)
T KOG2840|consen    4 RDEALCAVAKPTIRRPKQGQKLCGACFWEGFEAEIHPTIVANKLFARGERVAIGASGGKDSTVLAYVLDALNERHDYGLR   83 (347)
T ss_pred             ccccccccccchhcCcchhhHHHhhhhhhcchhhhhhhHhccCccCCCCccccccccchhHHHHHHHHHHhhhhcCCCce
Confidence            35667755567899999999999999999999999999999999999999999999999999999999999999889999


Q ss_pred             EEEEEecCCCCCCChhhHHHHHHHHHHhCCCeEEEeeccccC-CCHHHHHHHhC--CCCCchhHHHHHHHHHHHHHHHCC
Q 041164           94 LFLLSIDEGISGYRDDSLQTVKRNEIQYGLPLKIVSYKDLYG-WTMDEIVKVIG--LKNNCTFCGVFRRQALDRGASLLK  170 (357)
Q Consensus        94 v~av~id~g~~~~~~~~~~~v~~~~~~lgi~~~iv~~~~~~~-~~i~~~~~~~~--~~~~c~~c~~~r~~~l~~~A~~~g  170 (357)
                      +.++.+|+|+++|.+.++..+++...++|+|+.++++++.++ ++++++....+  .++.|++|+.+|+++|.+-|...|
T Consensus        84 l~Lls~degi~gyrd~sl~avkrn~~~~~lPL~ivs~~dl~~~~tmd~i~~~i~~~~rn~ctfCgv~RrqaL~~ga~~l~  163 (347)
T KOG2840|consen   84 LFLLSIDEGIRGYRDDSLEAVKRNGVQYGLPLCIVSYKDLYGEWTMDEIVSEIGQEIRNNCTFCGVFRRQALDRGADVLG  163 (347)
T ss_pred             eeeeeccccccceeccHHHHHHHhhhhcCCceEEecHHHHhccchHHHHHHHHhhhhhcCceeecHHHHHHHHhhccccc
Confidence            999999999999999999999999999999999999999998 99999998877  789999999999999999999999


Q ss_pred             CCEEEcCCChhHHHHHHHHHHHccCccccccccccccCC-C-CCccccccCCcCCHHHHHHHHHHHcCCcccccCCCCCC
Q 041164          171 VDKIATGHNADDIAETVLLNILRGDIARLSRCTLITTGE-D-GPIPRCKPFKYTYEKEIMFTYAYFKRLDYFSTECIYSP  248 (357)
Q Consensus       171 ~~~I~tGh~~dD~aet~l~~l~rG~~~~l~~~~~~~~~~-~-~~i~~irPL~~~~k~EI~~~ya~~~~i~~~~~~~~~~~  248 (357)
                      +..++||||+||.++|+|||+++|+..++.+........ . +.+++.+||.+.+++||.. |+....+.|+.++|.|++
T Consensus       164 ~~~~~tghnaDD~aetvl~n~lrgds~rl~R~~~~~t~~~e~~~~~r~kplk~~~~keivL-ya~~~~L~yFs~eCv~ap  242 (347)
T KOG2840|consen  164 AAELVTGHNADDWAETVLMNLLRGDSARLERLTEITTPSLEMGIIPRLKPLKYASEKEIVL-YASLSKLRYFSTECVKAP  242 (347)
T ss_pred             hhhhhhcccchHHHHHHHHHHHHhHHHHhhhccccccCccccCccccccccccchhhehhh-HHHHHHHHHHHHhhccCC
Confidence            999999999999999999999999988888887776553 3 3588999999999999999 999999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHhCChhHHHHHHhhhhccccccccCcccccccccccccccc-cchhhHHHHHhhcCCCCcceecc
Q 041164          249 NAYRGFAREFIKDLERLRPRAILDIIKSGENFRISTSTKMPEQGTCERCGYISSQK-WCKACVLLEGLNRGLPKMGIVRS  327 (357)
Q Consensus       249 ~~~r~~ir~~l~~Le~~~p~~~~~i~~t~~~l~~~~~~~~~~~~~C~~Cg~p~~~~-~c~~c~~~~~~~~~~~~~~~~~~  327 (357)
                      +++|...+.+|..|+...|+++-++.++++.+......+.++...|.+||..++.. +|.+|.+++.++..+|++.+.+.
T Consensus       243 ~a~rg~~r~~lk~le~~~P~~lmd~~rs~e~~~~~~~~~~p~~g~C~~C~~iss~~r~ckacallegln~~~~~~~~~~~  322 (347)
T KOG2840|consen  243 GASRGDARILLKDLERERPRILMDYCRSGEFLEFKDIAGAPTPGTCSRCGFISSQKRPCKACALLEGLNKGAPGLGLGDK  322 (347)
T ss_pred             cchHHHHHHHhhhhhhhCchHHHHHHhhhHHHhhhHhhcCCCCcchhhhHHHhcchhhHHHHHHHHhHhccCcccccccc
Confidence            99999999999999999999999999999888876555667889999999999988 99999999999999999999954


Q ss_pred             c
Q 041164          328 R  328 (357)
Q Consensus       328 ~  328 (357)
                      .
T Consensus       323 ~  323 (347)
T KOG2840|consen  323 A  323 (347)
T ss_pred             c
Confidence            3

>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional	Back alignment and domain information

>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,]	Back alignment and domain information

>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional	Back alignment and domain information

>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily	Back alignment and domain information

>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain	Back alignment and domain information

>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG2594 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK08349 hypothetical protein; Validated	Back alignment and domain information

>PRK00143 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed	Back alignment and domain information

>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional	Back alignment and domain information

>cd01998 tRNA_Me_trans tRNA methyl transferase	Back alignment and domain information

>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway	Back alignment and domain information

>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase	Back alignment and domain information

>PRK00074 guaA GMP synthase; Reviewed	Back alignment and domain information

>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase	Back alignment and domain information

>TIGR00884 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit	Back alignment and domain information

>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily	Back alignment and domain information

>PRK14664 tRNA-specific 2-thiouridylase MnmA; Provisional	Back alignment and domain information

>TIGR00268 conserved hypothetical protein TIGR00268	Back alignment and domain information

>PRK00919 GMP synthase subunit B; Validated	Back alignment and domain information

>PRK08384 thiamine biosynthesis protein ThiI; Provisional	Back alignment and domain information

>PRK13820 argininosuccinate synthase; Provisional	Back alignment and domain information

>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional	Back alignment and domain information

>PRK14561 hypothetical protein; Provisional	Back alignment and domain information

>PF03054 tRNA_Me_trans: tRNA methyl transferase; InterPro: IPR004506 tRNA-specific 2-thiouridylase catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34	Back alignment and domain information

>PRK05253 sulfate adenylyltransferase subunit 2; Provisional	Back alignment and domain information

>TIGR00269 conserved hypothetical protein TIGR00269	Back alignment and domain information

>TIGR00342 thiazole biosynthesis/tRNA modification protein ThiI	Back alignment and domain information

>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase	Back alignment and domain information

>PRK08576 hypothetical protein; Provisional	Back alignment and domain information

>COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00552 nadE NAD+ synthetase	Back alignment and domain information

>PRK00509 argininosuccinate synthase; Provisional	Back alignment and domain information

>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only]	Back alignment and domain information

>TIGR02039 CysD sulfate adenylyltransferase, small subunit	Back alignment and domain information

>TIGR00364 exsB protein	Back alignment and domain information

>cd01999 Argininosuccinate_Synthase Argininosuccinate synthase	Back alignment and domain information

>PRK02090 phosphoadenosine phosphosulfate reductase; Provisional	Back alignment and domain information

>TIGR00032 argG argininosuccinate synthase	Back alignment and domain information

>cd01995 ExsB ExsB is a transcription regulator related protein	Back alignment and domain information

>PRK11106 queuosine biosynthesis protein QueC; Provisional	Back alignment and domain information

>PRK01565 thiamine biosynthesis protein ThiI; Provisional	Back alignment and domain information

>PLN00200 argininosuccinate synthase; Provisional	Back alignment and domain information

>PRK04527 argininosuccinate synthase; Provisional	Back alignment and domain information

>TIGR03573 WbuX N-acetyl sugar amidotransferase	Back alignment and domain information

>PF02568 ThiI: Thiamine biosynthesis protein (ThiI); InterPro: IPR020536 Thiamine pyrophosphate (TPP) is synthesized de novo in many bacteria and is a required cofactor for many enzymes in the cell	Back alignment and domain information

>PRK12563 sulfate adenylyltransferase subunit 2; Provisional	Back alignment and domain information

>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD)	Back alignment and domain information

>PF06508 QueC: Queuosine biosynthesis protein QueC; InterPro: IPR018317 This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome	Back alignment and domain information

>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases	Back alignment and domain information

>PRK13980 NAD synthetase; Provisional	Back alignment and domain information

>PLN02347 GMP synthetase	Back alignment and domain information

>COG0603 Predicted PP-loop superfamily ATPase [General function prediction only]	Back alignment and domain information

>KOG2805 consensus tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily	Back alignment and domain information

>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK08557 hypothetical protein; Provisional	Back alignment and domain information

>PRK05370 argininosuccinate synthase; Validated	Back alignment and domain information

>PRK13795 hypothetical protein; Provisional	Back alignment and domain information

>PF01507 PAPS_reduct: Phosphoadenosine phosphosulfate reductase family; InterPro: IPR002500 This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase	Back alignment and domain information

>PRK13794 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00434 cysH phosophoadenylyl-sulfate reductase (thioredoxin)	Back alignment and domain information

>TIGR02057 PAPS_reductase phosphoadenosine phosphosulfate reductase, thioredoxin dependent	Back alignment and domain information

>PF02540 NAD_synthase: NAD synthase; InterPro: IPR022310 NAD+ synthase (6	Back alignment and domain information

>COG0301 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzyme metabolism]	Back alignment and domain information

>COG0137 ArgG Argininosuccinate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily	Back alignment and domain information

>PF00764 Arginosuc_synth: Arginosuccinate synthase; InterPro: IPR001518 Argininosuccinate synthase (6	Back alignment and domain information

>PRK02628 nadE NAD synthetase; Reviewed	Back alignment and domain information

>COG0175 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PTZ00323 NAD+ synthase; Provisional	Back alignment and domain information

>TIGR03679 arCOG00187 arCOG00187 universal archaeal metal-binding-domain/4Fe-4S-binding-domain containing ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK00876 nadE NAD synthetase; Reviewed	Back alignment and domain information

>PF10288 DUF2392: Protein of unknown function (DUF2392); InterPro: IPR019407 Cytoplasmic thiouridylase is a highly conserved complex responsible for the 2-thiolation of cytosolic tRNAs []	Back alignment and domain information

>COG2117 Predicted subunit of tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK00768 nadE NAD synthetase; Reviewed	Back alignment and domain information

>PRK13981 NAD synthetase; Provisional	Back alignment and domain information

>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF)	Back alignment and domain information

>TIGR03183 DNA_S_dndC putative sulfurtransferase DndC	Back alignment and domain information

>COG1365 Predicted ATPase (PP-loop superfamily) [General function prediction only]	Back alignment and domain information

>cd01991 Asn_Synthase_B_C The C-terminal domain of Asparagine Synthase B	Back alignment and domain information

>COG0171 NadE NAD synthase [Coenzyme metabolism]	Back alignment and domain information

>PRK06850 hypothetical protein; Provisional	Back alignment and domain information

>PF00733 Asn_synthase: Asparagine synthase; InterPro: IPR001962 This domain is always found associated with (IPR000583 from INTERPRO)	Back alignment and domain information

>TIGR02055 APS_reductase thioredoxin-dependent adenylylsulfate APS reductase	Back alignment and domain information

>TIGR01536 asn_synth_AEB asparagine synthase (glutamine-hydrolyzing)	Back alignment and domain information

>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent	Back alignment and domain information

>PLN02309 5'-adenylylsulfate reductase	Back alignment and domain information

>KOG1706 consensus Argininosuccinate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1622 consensus GMP synthase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR00289 conserved hypothetical protein TIGR00289	Back alignment and domain information

>COG3969 Predicted phosphoadenosine phosphosulfate sulfotransferase [General function prediction only]	Back alignment and domain information

>TIGR00290 MJ0570_dom MJ0570-related uncharacterized domain	Back alignment and domain information

>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only]	Back alignment and domain information

>PF01902 ATP_bind_4: ATP-binding region; InterPro: IPR002761 This domain is about 200 amino acids long with a strongly conserved motif SGGKD at the N-terminal	Back alignment and domain information

>PLN02549 asparagine synthase (glutamine-hydrolyzing)	Back alignment and domain information

>PTZ00077 asparagine synthetase-like protein; Provisional	Back alignment and domain information

>PRK09431 asnB asparagine synthetase B; Provisional	Back alignment and domain information

>TIGR03108 eps_aminotran_1 exosortase 1 system-associated amidotransferase 1	Back alignment and domain information

>PLN02339 NAD+ synthase (glutamine-hydrolysing)	Back alignment and domain information

>TIGR03104 trio_amidotrans asparagine synthase family amidotransferase	Back alignment and domain information

>COG0367 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0571 consensus Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism]	Back alignment and domain information

>PF02677 DUF208: Uncharacterized BCR, COG1636; InterPro: IPR003828 This entry describes proteins of unknown function	Back alignment and domain information

>COG1636 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family	Back alignment and domain information

>KOG0189 consensus Phosphoadenosine phosphosulfate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea	Back alignment and domain information

>PRK10490 sensor protein KdpD; Provisional	Back alignment and domain information

>KOG2316 consensus Predicted ATPase (PP-loop superfamily) [General function prediction only]	Back alignment and domain information

>cd00293 USP_Like Usp: Universal stress protein family	Back alignment and domain information

>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms]	Back alignment and domain information

>PRK09982 universal stress protein UspD; Provisional	Back alignment and domain information

>PRK15118 universal stress global response regulator UspA; Provisional	Back alignment and domain information

>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases	Back alignment and domain information

>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria	Back alignment and domain information

>PRK10116 universal stress protein UspC; Provisional	Back alignment and domain information

>KOG0573 consensus Asparagine synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK15005 universal stress protein F; Provisional	Back alignment and domain information

>TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component	Back alignment and domain information

>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents	Back alignment and domain information

>PRK15456 universal stress protein UspG; Provisional	Back alignment and domain information

>PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed	Back alignment and domain information

>COG1440 CelA Phosphotransferase system cellobiose-specific component IIB [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS)	Back alignment and domain information

>PTZ00218 40S ribosomal protein S29; Provisional	Back alignment and domain information

>PF02132 RecR: RecR protein; InterPro: IPR023628 The bacterial protein RecR seems to play a role in a recombinational process of DNA repair []	Back alignment and domain information

>KOG2303 consensus Predicted NAD synthase, contains CN hydrolase domain [Coenzyme transport and metabolism; General function prediction only]	Back alignment and domain information

>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed	Back alignment and domain information

>PRK11175 universal stress protein UspE; Provisional	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG3425 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK11175 universal stress protein UspE; Provisional	Back alignment and domain information

>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		357
1wy5_A		317	TILS, hypothetical UPF0072 protein AQ_1887; N-type	2e-20
3a2k_A		464	TRNA(Ile)-lysidine synthase; ligase, pseudo-knot,	8e-19
1ni5_A		433	Putative cell cycle protein MESJ; structural genom	2e-17
3k32_A		203	Uncharacterized protein MJ0690; predicted subunit	1e-13

>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Length = 317	Back alignment and structure

 Score = 89.2 bits (222), Expect = 2e-20
 Identities = 30/162 (18%), Positives = 55/162 (33%), Gaps = 20/162 (12%)

Query: 39  CFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLS 98
                   ++  +    ++F    R+ I  SGG DS VL  VL +L    +   ++ L  
Sbjct: 2   NPESRVIRKVLALQNDEKIFSGERRVLIAFSGGVDSVVLTDVLLKLKNYFS-LKEVALAH 60

Query: 99  IDEGISGYRDDSLQTVKRNEIQYGLPLKIVSYKDLYGWTMDEIVKVIGLKNNCTFCGV-- 156
            +  +    +   +  K    +  + + +          +    K   +        +  
Sbjct: 61  FNHMLRESAERDEEFCKEFAKERNMKIFVGK------EDVRAFAKENRM-------SLEE 107

Query: 157 ----FRRQALDRGASLLKVDKIATGHNADDIAETVLLNILRG 194
                R + L         D IAT H+ +D+ ET LL   RG
Sbjct: 108 AGRFLRYKFLKEILESEGFDCIATAHHLNDLLETSLLFFTRG 149

PyMOL of 1wy5

>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Length = 464	Back alignment and structure

>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Length = 433	Back alignment and structure

>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Length = 203	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		357
1wy5_A		317	TILS, hypothetical UPF0072 protein AQ_1887; N-type	100.0
3a2k_A		464	TRNA(Ile)-lysidine synthase; ligase, pseudo-knot,	100.0
1ni5_A		433	Putative cell cycle protein MESJ; structural genom	100.0
2der_A		380	TRNA-specific 2-thiouridylase MNMA; protein-RNA co	99.93
2hma_A		376	Probable tRNA (5-methylaminomethyl-2-thiouridylat	99.93
3k32_A		203	Uncharacterized protein MJ0690; predicted subunit	99.93
2dpl_A		308	GMP synthetase, GMP synthase [glutamine-hydrolyzin	99.92
3bl5_A		219	Queuosine biosynthesis protein QUEC; PREQ1 biosynt	99.91
3tqi_A		527	GMP synthase [glutamine-hydrolyzing]; ligase; 2.84	99.9
1sur_A		215	PAPS reductase; assimilatory sulfate reduction, 3-	99.89
2c5s_A		413	THII, probable thiamine biosynthesis protein THII;	99.89
2pg3_A		232	Queuosine biosynthesis protein QUEC; YP_049261.1,	99.89
2ywb_A		503	GMP synthase [glutamine-hydrolyzing]; GMP syntheta	99.89
1k92_A		455	Argininosuccinate synthase, argininosuccinate SY;	99.86
1kor_A		400	Argininosuccinate synthetase; ligase, riken struct	99.86
1zun_A		325	Sulfate adenylyltransferase subunit 2; beta barrel	99.85
2o8v_A		252	Phosphoadenosine phosphosulfate reductase; disulfi	99.85
2e18_A		257	NH(3)-dependent NAD(+) synthetase; ligase, structu	99.85
3uow_A		556	GMP synthetase; structural genomics consortium, SG	99.84
2nz2_A		413	Argininosuccinate synthase; amino-acid biosynthesi	99.84
3p52_A		249	NH(3)-dependent NAD(+) synthetase; structural geno	99.84
3fiu_A		249	NH(3)-dependent NAD(+) synthetase; rossman fold, a	99.83
2oq2_A		261	Phosphoadenosine phosphosulfate reductase; sulfate	99.83
1gpm_A		525	GMP synthetase, XMP aminase; class I glutamine ami	99.83
1xng_A		268	NH(3)-dependent NAD(+) synthetase; amidotransferas	99.82
1vl2_A		421	Argininosuccinate synthase; TM1780, structural gen	99.81
2vxo_A		697	GMP synthase [glutamine-hydrolyzing]; proto-oncoge	99.79
2wsi_A		306	FAD synthetase; transferase, nucleotidyltransferas	99.79
2goy_A		275	Adenosine phosphosulfate reductase; iron sulfur cl	99.76
1wxi_A		275	NH(3)-dependent NAD(+) synthetase; NADE, E.coli, l	99.66
1kqp_A		271	NAD+ synthase, NH(3)-dependent NAD(+) synthetase,	99.65
1vbk_A		307	Hypothetical protein PH1313; structural genomics,	99.61
3q4g_A		279	NH(3)-dependent NAD(+) synthetase; structural geno	99.59
3dpi_A		285	NAD+ synthetase; ssgcid, decode, structural genomi	99.56
3n05_A		590	NH(3)-dependent NAD(+) synthetase; ligase, structu	99.53
3fwk_A		308	FMN adenylyltransferase; FAD biosynthesis, alpha/b	99.38
3ilv_A		634	Glutamine-dependent NAD(+) synthetase; protein str	99.2
3sdb_A		680	Glutamine-dependent NAD(+) synthetase; glutamine-a	99.2
3rjz_A		237	N-type ATP pyrophosphatase superfamily; structural	99.19
1jgt_A		513	Beta-lactam synthetase; asparagine synthetase, cla	98.98
1ct9_A		553	Asparagine synthetase B; amidotransferase, substra	98.94
1q15_A		503	CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS,	98.93
4f4h_A		565	Glutamine dependent NAD+ synthetase; structural ge	98.68
3hgm_A		147	Universal stress protein TEAD; rossman fold, signa	96.04
1jmv_A		141	USPA, universal stress protein A; chaperone; 1.85A	95.8
3fdx_A		143	Putative filament protein / universal stress PROT;	95.78
3tnj_A		150	Universal stress protein (USP); structural genomic	95.42
2z08_A		137	Universal stress protein family; uncharacterized c	95.39
3loq_A		294	Universal stress protein; structural genomics, PSI	95.17
3dlo_A		155	Universal stress protein; unknown function, struct	95.04
3idf_A		138	USP-like protein; universal, stress, PSI, MCSG, st	95.02
3s3t_A		146	Nucleotide-binding protein, universal stress PROT	94.91
1tq8_A		163	Hypothetical protein RV1636; MTCY01B2.28, structur	94.79
2dum_A		170	Hypothetical protein PH0823; conserved hypothetica	94.63
1mjh_A		162	Protein (ATP-binding domain of protein MJ0577); hy	93.99
3fg9_A		156	Protein of universal stress protein USPA family; A	93.5
3mt0_A		290	Uncharacterized protein PA1789; structural genomic	93.23
3mt0_A		290	Uncharacterized protein PA1789; structural genomic	92.76
3nbm_A		108	PTS system, lactose-specific IIBC components; PTS_	92.63
1q77_A		138	Hypothetical protein AQ_178; structural genomics,	91.65
2gm3_A		175	Unknown protein; AT3G01520, putative ethylene-resp	91.16
3olq_A		319	Universal stress protein E; structural genomics, P	90.61
3n0v_A		286	Formyltetrahydrofolate deformylase; formyl transfe	85.19
3o1l_A		302	Formyltetrahydrofolate deformylase; structural gen	84.27
3loq_A		294	Universal stress protein; structural genomics, PSI	84.19
3lou_A		292	Formyltetrahydrofolate deformylase; structural gen	83.15
2qv5_A		261	AGR_C_5032P, uncharacterized protein ATU2773; stru	82.25
3cis_A		309	Uncharacterized protein; alpha/beta hydrolase, ATP	82.2
3olq_A		319	Universal stress protein E; structural genomics, P	81.21

>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A*	Back alignment and structure

Probab=100.00  E-value=6.5e-40  Score=311.24  Aligned_cols=229  Identities=22%  Similarity=0.199  Sum_probs=200.9

Q ss_pred             HHHHHHHHHHHHHHhhcCCCCCCCEEEEEecCChhHHHHHHHHHHHhhhCCCCee-EEEEEecCCCCCCChhhHHHHHHH
Q 041164           39 CFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLD-LFLLSIDEGISGYRDDSLQTVKRN  117 (357)
Q Consensus        39 cf~~~~~~kv~~~i~k~~l~~~~~kvlVa~SGG~DS~~LL~ll~~~~~~~~~g~~-v~av~id~g~~~~~~~~~~~v~~~  117 (357)
                      |....+.++|.++|.+++++.++++|+||+|||+||++||+++.++.+.  +|++ +.++|||||++..++++.++++++
T Consensus         2 ~~~~~~~~~~~~~i~~~~l~~~~~~vlva~SGG~DS~~Ll~ll~~~~~~--~g~~~v~av~vd~g~r~~s~~~~~~v~~~   79 (317)
T 1wy5_A            2 NPESRVIRKVLALQNDEKIFSGERRVLIAFSGGVDSVVLTDVLLKLKNY--FSLKEVALAHFNHMLRESAERDEEFCKEF   79 (317)
T ss_dssp             CHHHHHHHHHHHHHHHHCSCSSCCEEEEECCSSHHHHHHHHHHHHSTTT--TTCSEEEEEEEECCSSTHHHHHHHHHHHH
T ss_pred             ccHHHHHHHHHHHHHHcCCCCCCCEEEEEecchHHHHHHHHHHHHHHHH--cCCCEEEEEEEECCCCcccHHHHHHHHHH
Confidence            5677899999999999999999999999999999999999999987443  4788 999999999986567888999999


Q ss_pred             HHHhCCCeEEEeeccccCCCHHHHHHHhCCCCCchhHHHHHHHHHHHHHHHCCCCEEEcCCChhHHHHHHHHHHHccCcc
Q 041164          118 EIQYGLPLKIVSYKDLYGWTMDEIVKVIGLKNNCTFCGVFRRQALDRGASLLKVDKIATGHNADDIAETVLLNILRGDIA  197 (357)
Q Consensus       118 ~~~lgi~~~iv~~~~~~~~~i~~~~~~~~~~~~c~~c~~~r~~~l~~~A~~~g~~~I~tGh~~dD~aet~l~~l~rG~~~  197 (357)
                      |+.+|+|+++++++.      ..+... ...++|..|+.+||.++.++|++.|+++|+||||+||++||+|+++++|++.
T Consensus        80 a~~lgi~~~v~~~~~------~~~~~~-~~~~~e~~ar~~Ry~~l~~~a~~~g~~~i~~Gh~~dD~~Et~l~~l~rg~g~  152 (317)
T 1wy5_A           80 AKERNMKIFVGKEDV------RAFAKE-NRMSLEEAGRFLRYKFLKEILESEGFDCIATAHHLNDLLETSLLFFTRGTGL  152 (317)
T ss_dssp             HHHHTCCEEEEECCH------HHHHHH-TTCCHHHHHHHHHHHHHHHHHHHTTCSEEECCCCHHHHHHHHHHHHHHCCCH
T ss_pred             HHHcCCcEEEEEEec------hhhhcc-CCCCHHHHHHHHHHHHHHHHHHHcCCCEEEEeCchhHHHHHHHHHHHhCCCc
Confidence            999999999998752      233322 3457888899999999999999999999999999999999999999999873


Q ss_pred             -ccccccccccCCCCCccccccCCcCCHHHHHHHHHHHcCCcccccCCCCCChhhHHHHH-HHHHHHHHhCChhHHHHHH
Q 041164          198 -RLSRCTLITTGEDGPIPRCKPFKYTYEKEIMFTYAYFKRLDYFSTECIYSPNAYRGFAR-EFIKDLERLRPRAILDIIK  275 (357)
Q Consensus       198 -~l~~~~~~~~~~~~~i~~irPL~~~~k~EI~~~ya~~~~i~~~~~~~~~~~~~~r~~ir-~~l~~Le~~~p~~~~~i~~  275 (357)
                       .+..+.+.    .  ..++|||++++++||+. |++.+|+||+.|+||.+..+.|+++| +++|.|++.||++..++++
T Consensus       153 ~gl~~~~~~----~--~~iirPLl~~~k~eI~~-~~~~~gl~~~~d~sn~~~~~~Rn~iR~~~lp~L~~~~p~~~~~l~~  225 (317)
T 1wy5_A          153 DGLIGFLPK----E--EVIRRPLYYVKRSEIEE-YAKFKGLRWVEDETNYEVSIPRNRIRHRVIPELKRINENLEDTFLK  225 (317)
T ss_dssp             HHHHCSCSE----E--TTEECTTTTCCHHHHHH-HHHHTTCCCCCCGGGGTCCHHHHHHHHTHHHHHHHHCTTHHHHHHH
T ss_pred             ccccCCCCC----C--CeEECCCccCCHHHHHH-HHHHcCCCeeECCCCCCCccHHHHHHHHHHHHHHHHCccHHHHHHH
Confidence             34444331    1  25799999999999999 99999999999999999999999999 5999999999999999999


Q ss_pred             hhhhcccc
Q 041164          276 SGENFRIS  283 (357)
Q Consensus       276 t~~~l~~~  283 (357)
                      ++++++..
T Consensus       226 ~~~~~~~~  233 (317)
T 1wy5_A          226 MVKVLRAE  233 (317)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHHHHH
Confidence            99988854

PyMOL of 1wy5

>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus}	Back alignment and structure

>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1	Back alignment and structure

>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A*	Back alignment and structure

>2hma_A Probable tRNA (5-methylaminomethyl-2-thiouridylat methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae}	Back alignment and structure

>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii}	Back alignment and structure

>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; pyrococcus horikoshii OT3, structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii} PDB: 2z0c_A 3a4i_A	Back alignment and structure

>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis}	Back alignment and structure

>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii}	Back alignment and structure

>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2	Back alignment and structure

>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1	Back alignment and structure

>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics, JOIN for structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1	Back alignment and structure

>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A*	Back alignment and structure

>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A*	Back alignment and structure

>1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A*	Back alignment and structure

>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2	Back alignment and structure

>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli}	Back alignment and structure

>2e18_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, NPPSFA, national project on Pro structural and functional analyses; 2.10A {Pyrococcus horikoshii}	Back alignment and structure

>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum}	Back alignment and structure

>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens}	Back alignment and structure

>3p52_A NH(3)-dependent NAD(+) synthetase; structural genomics, center for structural genomics of infec diseases, NADE, CSGI; 2.74A {Campylobacter jejuni} SCOP: c.26.2.0	Back alignment and structure

>3fiu_A NH(3)-dependent NAD(+) synthetase; rossman fold, adenine nucleotide alpha hydrolase-like, ATP- binding, ligase, nucleotide-binding; HET: AMP; 1.85A {Francisella tularensis subsp}	Back alignment and structure

>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae}	Back alignment and structure

>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1	Back alignment and structure

>1xng_A NH(3)-dependent NAD(+) synthetase; amidotransferase, ligase; HET: DND ATP; 1.70A {Helicobacter pylori} SCOP: c.26.2.1 PDB: 1xnh_A	Back alignment and structure

>1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics, ligase; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1	Back alignment and structure

>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens}	Back alignment and structure

>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae}	Back alignment and structure

>2goy_A Adenosine phosphosulfate reductase; iron sulfur cluster, nucleotide binding, thiosulfonate intermediate, oxidoreductase; HET: ADX; 2.70A {Pseudomonas aeruginosa}	Back alignment and structure

>1wxi_A NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase; HET: AMP; 1.70A {Escherichia coli} SCOP: c.26.2.1 PDB: 1wxf_A 1wxg_A* 1wxh_A* 1wxe_A* 3hmq_A*	Back alignment and structure

>1kqp_A NAD+ synthase, NH(3)-dependent NAD(+) synthetase, SPOR; ligase, amidotransferase, ATP pyrophosphatase, NAD-adenylate; HET: ADJ; 1.03A {Bacillus subtilis} SCOP: c.26.2.1 PDB: 1fyd_A* 1ifx_A* 1ee1_A* 1ih8_A* 1nsy_A* 2nsy_A* 2pzb_A 2pza_A* 2pz8_A	Back alignment and structure

>1vbk_A Hypothetical protein PH1313; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.90A {Pyrococcus horikoshii} SCOP: c.26.2.6 d.308.1.1	Back alignment and structure

>3q4g_A NH(3)-dependent NAD(+) synthetase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 2.40A {Vibrio cholerae} SCOP: c.26.2.0	Back alignment and structure

>3dpi_A NAD+ synthetase; ssgcid, decode, structural genomics, PSI, protein structure initiative; 2.20A {Burkholderia pseudomallei} SCOP: c.26.2.0	Back alignment and structure

>3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis}	Back alignment and structure

>3fwk_A FMN adenylyltransferase; FAD biosynthesis, alpha/beta protein, rossmann- like fold, APO-form, extended loop region; HET: BGC; 1.20A {Candida glabrata} PDB: 3g59_A* 3g5a_A* 3g6k_A*	Back alignment and structure

>3ilv_A Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>3sdb_A Glutamine-dependent NAD(+) synthetase; glutamine-amidotransferase, glutaminase, glutamine-dependent synthetase, ligase; 2.00A {Mycobacterium tuberculosis} PDB: 3seq_A* 3sez_A* 3szg_A* 3dla_A* 3syt_A*	Back alignment and structure

>3rjz_A N-type ATP pyrophosphatase superfamily; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein; 2.30A {Pyrococcus furiosus} SCOP: c.26.2.1 PDB: 3h7e_A 3rk0_A* 3rk1_A* 1ru8_A 2d13_A	Back alignment and structure

>1jgt_A Beta-lactam synthetase; asparagine synthetase, clavulanic AC AMPCPP, CEA, carboxyethylarginine, hydrolase; HET: APC CMA; 1.95A {Streptomyces clavuligerus} SCOP: c.26.2.1 d.153.1.1 PDB: 1m1z_A 1mb9_A* 1mbz_A* 1mc1_A*	Back alignment and structure

>1ct9_A Asparagine synthetase B; amidotransferase, substrate channeling, asparagine biosynthesis, ligase; HET: AMP GLN; 2.00A {Escherichia coli} SCOP: c.26.2.1 d.153.1.1	Back alignment and structure

>1q15_A CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lactam synthetase, AS-B, class B asparagine synthetase, AMP-CPP; 2.30A {Pectobacterium carotovorum} SCOP: c.26.2.1 d.153.1.1 PDB: 1q19_A*	Back alignment and structure

>4f4h_A Glutamine dependent NAD+ synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ligase; 1.75A {Burkholderia thailandensis}	Back alignment and structure

>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0	Back alignment and structure

>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4	Back alignment and structure

>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A*	Back alignment and structure

>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A*	Back alignment and structure

>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A	Back alignment and structure

>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus}	Back alignment and structure

>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A*	Back alignment and structure

>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes}	Back alignment and structure

>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0	Back alignment and structure

>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4	Back alignment and structure

>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii}	Back alignment and structure

>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4	Back alignment and structure

>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum}	Back alignment and structure

>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa}	Back alignment and structure

>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa}	Back alignment and structure

>3nbm_A PTS system, lactose-specific IIBC components; PTS_IIB_LACTOSE, phosphoenolpyruvate:carbohydrate system, P- phosphorylation; HET: MSE; 1.30A {Streptococcus pneumoniae}	Back alignment and structure

>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4	Back alignment and structure

>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4	Back alignment and structure

>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis}	Back alignment and structure

>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida}	Back alignment and structure

>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV}	Back alignment and structure

>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus}	Back alignment and structure

>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei}	Back alignment and structure

>2qv5_A AGR_C_5032P, uncharacterized protein ATU2773; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Agrobacterium tumefaciens str}	Back alignment and structure

>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A*	Back alignment and structure

>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		357
d1ni5a1		227	c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, T	1e-17
d1wy5a1		216	c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aqui	2e-13
d2c5sa1		218	c.26.2.6 (A:174-391) Thiamine biosynthesis protein	6e-13
d1zuna1		211	c.26.2.2 (A:1-211) Sulfate adenylyltransferase sub	1e-04
d1j20a1		165	c.26.2.1 (A:1-165) Argininosuccinate synthetase, N	1e-04

>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 227	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: PP-loop ATPase
domain: tRNA-Ile-lysidine synthetase, TilS, N-terminal domain
species: Escherichia coli [TaxId: 562]

 Score = 78.6 bits (192), Expect = 1e-17
 Identities = 45/228 (19%), Positives = 76/228 (33%), Gaps = 17/228 (7%)

Query: 55  NQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYRDDSLQTV 114
           N+      +I +  SGG DSTVL   L +  R  N G+ L  + +  G+S   D  +   
Sbjct: 7   NRQLLTSRQILVAFSGGLDSTVLLHQLVQW-RTENPGVALRAIHVHHGLSANADAWVTHC 65

Query: 115 KRNEIQYGLPLKIVSYKDLYGWTMDEIVKVIGLKNNCTFCGVFRRQALDRGASLLKVDKI 174
           +    Q+ +PL +   +        E                 + +      +LL  + +
Sbjct: 66  ENVCQQWQVPLVVERVQLAQEGLGIE-------------AQARQARYQAFARTLLPGEVL 112

Query: 175 ATGHNADDIAETVLLNILRGDIARLSRCTLITTGEDGPIPRCKPFKYTYEKEIMFTYAYF 234
            T  + DD  ET LL + RG         +    E       +P       E +  +A  
Sbjct: 113 VTAQHLDDQCETFLLALKRGSGPA-GLSAMAEVSEFAGTRLIRPLLARTRGE-LVQWARQ 170

Query: 235 KRLDYFSTECIYSPNAYRGFAR-EFIKDLERLRPRAILDIIKSGENFR 281
             L +   E     +  R F R   +  L++  P       +S     
Sbjct: 171 YDLRWIEDESNQDDSYDRNFLRLRVVPLLQQRWPHFAEATARSAALCA 218

PyMOL of d1ni5a1

>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Length = 216	Back information, alignment and structure

>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Length = 218	Back information, alignment and structure

>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 211	Back information, alignment and structure

>d1j20a1 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 165	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		357
d1wy5a1		216	TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId	100.0
d1ni5a1		227	tRNA-Ile-lysidine synthetase, TilS, N-terminal dom	100.0
d2c5sa1		218	Thiamine biosynthesis protein ThiI, C-terminal dom	99.93
d1k92a1		188	Argininosuccinate synthetase, N-terminal domain {E	99.74
d1zuna1		211	Sulfate adenylyltransferase subunit 2, CysD {Pseud	99.66
d1sura_		215	Phosphoadenylyl sulphate (PAPS) reductase {Escheri	99.65
d1j20a1		165	Argininosuccinate synthetase, N-terminal domain {T	99.63
d1gpma1		197	GMP synthetase, central domain {Escherichia coli [	99.63
d1vl2a1		168	Argininosuccinate synthetase, N-terminal domain {T	99.61
d2pg3a1		230	Queuosine biosynthesis protein QueC {Erwinia carot	99.59
d1xnga1		255	NH3-dependent NAD+-synthetase {Helicobacter pylori	99.55
d1vbka1		132	Hypothetical protein PH1313, C-terminal domain {Ar	99.25
d1wxia1		274	NH3-dependent NAD+-synthetase {Escherichia coli [T	99.25
d1kqpa_		271	NH3-dependent NAD+-synthetase {Bacillus subtilis [	99.1
d2d13a1		226	Hypothetical protein PH1257 {Archaeon Pyrococcus h	98.87
d1jgta1		299	beta-Lactam synthetase {Streptomyces clavuligerus	98.79
d1q15a1		296	beta-Lactam synthetase {Pectobacterium carotovorum	98.76
d1ct9a1		324	Asparagine synthetase B, C-terminal domain {Escher	98.44
d1jmva_		140	Universal stress protein A, UspA {Haemophilus infl	96.04
d2z3va1		135	Hypothetical protein TTHA0895 {Thermus thermophilu	94.92
d1q77a_		138	Hypothetical protein Aq_178 {Aquifex aeolicus [Tax	94.77
d1mjha_		160	"Hypothetical" protein MJ0577 {Archaeon Methanococ	93.99
d1tq8a_		147	Hypothetical protein Rv1636 {Mycobacterium tubercu	93.85
d1ibia2		31	Cysteine-rich (intestinal) protein, CRP, CRIP {Jap	90.02
d2gm3a1		171	Putative ethylene-responsive protein AT3g01520/F4P	89.9
d2qy9a2		211	GTPase domain of the signal recognition particle r	84.64
d1iiba_		103	Enzyme IIB-cellobiose {Escherichia coli [TaxId: 56	81.96
d1okkd2		207	GTPase domain of the signal recognition particle r	81.22
d1ls1a2		207	GTPase domain of the signal sequence recognition p	81.17
d1vmaa2		213	GTPase domain of the signal recognition particle r	80.69
d2cuqa1		32	Four and a half LIM domains 3, FHL3 {Human (Homo s	80.69
d1x4ka1		32	Four and a half LIM domains protein 2, FHL2 {Human	80.59

>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: PP-loop ATPase
domain: TilS-like protein Aq 1887
species: Aquifex aeolicus [TaxId: 63363]

Probab=100.00  E-value=3.7e-42  Score=307.24  Aligned_cols=211  Identities=21%  Similarity=0.189  Sum_probs=180.8

Q ss_pred             HHHHHHHHHHHhhcCCCCCCCEEEEEecCChhHHHHHHHHHHHhhhCCCCeeEEEEEecCCCCCCChhhHHHHHHHHHHh
Q 041164           42 EVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYRDDSLQTVKRNEIQY  121 (357)
Q Consensus        42 ~~~~~kv~~~i~k~~l~~~~~kvlVa~SGG~DS~~LL~ll~~~~~~~~~g~~v~av~id~g~~~~~~~~~~~v~~~~~~l  121 (357)
                      ..+.+++.+.+.+++++.++++|+||+|||+||++|||+|.++...++ ...+.++|||||++..+..+.+.++++|+.+
T Consensus         5 ~~~~~k~~~~~~~~~l~~~~~kv~Va~SGG~DS~~Ll~lL~~~~~~~~-~~~i~~~~vdh~~r~~s~~~~~~~~~~~~~l   83 (216)
T d1wy5a1           5 SRVIRKVLALQNDEKIFSGERRVLIAFSGGVDSVVLTDVLLKLKNYFS-LKEVALAHFNHMLRESAERDEEFCKEFAKER   83 (216)
T ss_dssp             HHHHHHHHHHHHHHCSCSSCCEEEEECCSSHHHHHHHHHHHHSTTTTT-CSEEEEEEEECCSSTHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHhccCCCCeEEEEeCCcHHHHHHHHHHHHHHHhcC-CCcEEEEEeecccccchhhhhhHHHHHHHhh
Confidence            467889999999999999999999999999999999999999755442 2379999999999887778889999999999


Q ss_pred             CCCeEEEeeccccCCCHHHHHHHhCCCCCchhHHHHHHHHHHHHHHHCCCCEEEcCCChhHHHHHHHHHHHccCcccccc
Q 041164          122 GLPLKIVSYKDLYGWTMDEIVKVIGLKNNCTFCGVFRRQALDRGASLLKVDKIATGHNADDIAETVLLNILRGDIARLSR  201 (357)
Q Consensus       122 gi~~~iv~~~~~~~~~i~~~~~~~~~~~~c~~c~~~r~~~l~~~A~~~g~~~I~tGh~~dD~aet~l~~l~rG~~~~l~~  201 (357)
                      |+++++.++...      ... .....+.|..|+..||.++.++|++.|+++|+||||+||++||+|+++++|++.  ..
T Consensus        84 ~i~~~i~~~~~~------~~~-~~~~~~~~~~~R~~Ry~~l~~~a~~~~~~~ia~GH~~dD~~Et~l~~l~rg~~~--~~  154 (216)
T d1wy5a1          84 NMKIFVGKEDVR------AFA-KENRMSLEEAGRFLRYKFLKEILESEGFDCIATAHHLNDLLETSLLFFTRGTGL--DG  154 (216)
T ss_dssp             TCCEEEEECCHH------HHH-HHTTCCHHHHHHHHHHHHHHHHHHHTTCSEEECCCCHHHHHHHHHHHHHHCCCH--HH
T ss_pred             hhhhhhhccchh------hhc-cCCccchHHHHHHHHHHHhhhhccccccceeEeeeeccchHHHHHHHhhcCCcc--cc
Confidence            999999877532      222 224556677889999999999999999999999999999999999999999863  33


Q ss_pred             ccccccCCCCCccccccCCcCCHHHHHHHHHHHcCCcccccCCCCCChhhHHHHH-HHHHHHHHhC
Q 041164          202 CTLITTGEDGPIPRCKPFKYTYEKEIMFTYAYFKRLDYFSTECIYSPNAYRGFAR-EFIKDLERLR  266 (357)
Q Consensus       202 ~~~~~~~~~~~i~~irPL~~~~k~EI~~~ya~~~~i~~~~~~~~~~~~~~r~~ir-~~l~~Le~~~  266 (357)
                      +.++.+   ....++|||+.++|+||.. ||+.+||||++|+||++..+.|+++| +++|.|++.|
T Consensus       155 l~~~~~---~~~~i~RPLl~~~k~eI~~-~a~~~~l~~~~D~sN~~~~~~Rn~iR~~l~p~l~~~n  216 (216)
T d1wy5a1         155 LIGFLP---KEEVIRRPLYYVKRSEIEE-YAKFKGLRWVEDETNYEVSIPRNRIRHRVIPELKRIN  216 (216)
T ss_dssp             HHCSCS---EETTEECTTTTCCHHHHHH-HHHHTTCCCCCCGGGGTCCHHHHHHHHTHHHHHHHHC
T ss_pred             ccCCCc---ccceecchhhcCCHHHHHH-HHHHcCCcEEECcCCCCCcccHHHHHHHHHHHHHhcC
Confidence            334322   1245789999999999999 99999999999999999999999999 7999999865

PyMOL of d1wy5a1

>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]}	Back information, alignment and structure

>d1k92a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]}	Back information, alignment and structure

>d1sura_ c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1j20a1 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1gpma1 c.26.2.1 (A:208-404) GMP synthetase, central domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vl2a1 c.26.2.1 (A:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2pg3a1 c.26.2.1 (A:1-230) Queuosine biosynthesis protein QueC {Erwinia carotovora [TaxId: 554]}	Back information, alignment and structure

>d1xnga1 c.26.2.1 (A:3-257) NH3-dependent NAD+-synthetase {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1wxia1 c.26.2.1 (A:2-275) NH3-dependent NAD+-synthetase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kqpa_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1jgta1 c.26.2.1 (A:210-508) beta-Lactam synthetase {Streptomyces clavuligerus [TaxId: 1901]}	Back information, alignment and structure

>d1q15a1 c.26.2.1 (A:206-501) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]}	Back information, alignment and structure

>d1ct9a1 c.26.2.1 (A:193-516) Asparagine synthetase B, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]}	Back information, alignment and structure

>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1iiba_ c.44.2.1 (A:) Enzyme IIB-cellobiose {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure