Citrus Sinensis ID: 041165

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MGRQPCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPDLKRGAFTEDEEDQIIQLHSLL
ccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHcHHHHHHHHHccccccccccccHHHHHHHHHHHHcc
ccccccccccccccccccHHHHHHHHHHHHHcccccHcHccHHccccccccccEEEEEHccccccccccccHHHHHHHHHHHHHc
mgrqpccdkvglkrgpwtieeDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINylrpdlkrgaftedeEDQIIQLHSLL
mgrqpccdkvglkrgpwtieEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLrpdlkrgaftedeedQIIQLHSLL
MGRQPCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPDLKRGAFTEDEEDQIIQLHSLL
*****CCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPDLKRGAF***************
**RQPCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPDLKRGAFTEDEEDQIIQLHSLL
MGRQPCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPDLKRGAFTEDEEDQIIQLHSLL
****PCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPDLKRGAFTEDEEDQIIQLHSLL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRQPCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPDLKRGAFTEDEEDQIIQLHSLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query85 2.2.26 [Sep-21-2011]
P80073 421 Myb-related protein Pp2 O N/A no 1.0 0.201 0.741 2e-34
Q50EX6 294 Protein ODORANT1 OS=Petun N/A no 1.0 0.289 0.741 2e-32
P81394 268 Myb-related protein 315 O N/A no 1.0 0.317 0.717 7e-32
P20024 340 Myb-related protein Zm1 O N/A no 0.988 0.247 0.678 7e-30
Q38851 236 Transcription repressor M no no 1.0 0.360 0.682 1e-29
Q8LPH6 352 Transcription factor MYB8 no no 1.0 0.241 0.658 1e-29
Q7XBH4 257 Myb-related protein Myb4 no no 1.0 0.330 0.682 2e-29
P20025 255 Myb-related protein Zm38 N/A no 1.0 0.333 0.682 3e-29
Q9SZP1 282 Transcription repressor M no no 1.0 0.301 0.670 3e-29
Q8GWP0 360 Transcription factor MYB3 no no 1.0 0.236 0.627 6e-29
>sp|P80073|MYB2_PHYPA Myb-related protein Pp2 OS=Physcomitrella patens subsp. patens GN=PP2 PE=2 SV=1 Back     alignment and function desciption
 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 73/85 (85%)

Query: 1  MGRQPCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINY 60
          MGR+PCC+KVGL+RGPWT EED KL+S I NNG+ CWR +PKLAGLLRCGKSCRLRW NY
Sbjct: 1  MGRKPCCEKVGLRRGPWTSEEDQKLVSHITNNGLSCWRAIPKLAGLLRCGKSCRLRWTNY 60

Query: 61 LRPDLKRGAFTEDEEDQIIQLHSLL 85
          LRPDLKRG F+E EE+ I+ LH+ L
Sbjct: 61 LRPDLKRGIFSEAEENLILDLHATL 85
Possible transcription activator.
Physcomitrella patens subsp. patens (taxid: 145481)
>sp|Q50EX6|ODO1_PETHY Protein ODORANT1 OS=Petunia hybrida GN=ODO1 PE=2 SV=1 Back     alignment and function description
>sp|P81394|MYB15_ANTMA Myb-related protein 315 OS=Antirrhinum majus GN=MYB315 PE=2 SV=1 Back     alignment and function description
>sp|P20024|MYB1_MAIZE Myb-related protein Zm1 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function description
>sp|Q8LPH6|MYB86_ARATH Transcription factor MYB86 OS=Arabidopsis thaliana GN=MYB86 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 Back     alignment and function description
>sp|P20025|MYB38_MAIZE Myb-related protein Zm38 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|Q8GWP0|MYB39_ARATH Transcription factor MYB39 OS=Arabidopsis thaliana GN=MYB39 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query85
356573735 273 PREDICTED: myb-related protein 315-like 1.0 0.311 0.941 5e-41
296081315 405 unnamed protein product [Vitis vinifera] 1.0 0.209 0.929 6e-41
255571980 242 r2r3-myb transcription factor, putative 1.0 0.351 0.929 7e-41
356560528 276 PREDICTED: myb-related protein 315-like 1.0 0.307 0.929 9e-41
359488652 268 PREDICTED: myb-related protein 315-like 1.0 0.317 0.929 1e-40
449492951 305 PREDICTED: protein ODORANT1-like [Cucumi 1.0 0.278 0.917 2e-40
224055659 282 predicted protein [Populus trichocarpa] 1.0 0.301 0.894 2e-39
356513834 273 PREDICTED: myb-related protein 315-like 1.0 0.311 0.894 4e-39
255547912146 r2r3-myb transcription factor, putative 1.0 0.582 0.905 7e-39
15241377 263 myb domain protein 40 [Arabidopsis thali 1.0 0.323 0.858 1e-38
>gi|356573735|ref|XP_003555012.1| PREDICTED: myb-related protein 315-like [Glycine max] Back     alignment and taxonomy information
 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 81/85 (95%)

Query: 1  MGRQPCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINY 60
          MGRQPCCDKVGLKRGPWTIEEDHKLM+FILNNGIHCWR VPKLAGLLRCGKSCRLRWINY
Sbjct: 1  MGRQPCCDKVGLKRGPWTIEEDHKLMNFILNNGIHCWRTVPKLAGLLRCGKSCRLRWINY 60

Query: 61 LRPDLKRGAFTEDEEDQIIQLHSLL 85
          LRPDLKRG FTE EEDQIIQLHS L
Sbjct: 61 LRPDLKRGGFTEMEEDQIIQLHSCL 85

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296081315|emb|CBI17697.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255571980|ref|XP_002526931.1| r2r3-myb transcription factor, putative [Ricinus communis] gi|223533683|gb|EEF35418.1| r2r3-myb transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356560528|ref|XP_003548543.1| PREDICTED: myb-related protein 315-like [Glycine max] Back     alignment and taxonomy information
>gi|359488652|ref|XP_002271033.2| PREDICTED: myb-related protein 315-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449492951|ref|XP_004159150.1| PREDICTED: protein ODORANT1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224055659|ref|XP_002298589.1| predicted protein [Populus trichocarpa] gi|222845847|gb|EEE83394.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356513834|ref|XP_003525613.1| PREDICTED: myb-related protein 315-like [Glycine max] Back     alignment and taxonomy information
>gi|255547912|ref|XP_002515013.1| r2r3-myb transcription factor, putative [Ricinus communis] gi|223546064|gb|EEF47567.1| r2r3-myb transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15241377|ref|NP_196938.1| myb domain protein 40 [Arabidopsis thaliana] gi|7573459|emb|CAB87773.1| MYB40-putative transcription factor [Arabidopsis thaliana] gi|41619392|gb|AAS10092.1| MYB transcription factor [Arabidopsis thaliana] gi|332004636|gb|AED92019.1| myb domain protein 40 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query85
TAIR|locus:2145648 263 MYB40 "myb domain protein 40" 1.0 0.323 0.858 3.3e-40
TAIR|locus:2174195 327 MYB43 "myb domain protein 43" 1.0 0.259 0.764 4.6e-34
TAIR|locus:2205283 282 MYB20 "myb domain protein 20" 1.0 0.301 0.752 3.2e-33
TAIR|locus:2132584 266 MYB85 "myb domain protein 85" 1.0 0.319 0.717 1.8e-32
TAIR|locus:2086233 285 MYB15 "myb domain protein 15" 1.0 0.298 0.717 1.3e-31
TAIR|locus:2139144 286 MYB42 "myb domain protein 42" 1.0 0.297 0.705 3.3e-31
TAIR|locus:2098906 299 MYB17 "myb domain protein 17" 1.0 0.284 0.705 4.2e-31
TAIR|locus:2038520 246 MYB13 "myb domain protein 13" 1.0 0.345 0.694 3.8e-30
TAIR|locus:2133677 236 MYB6 "myb domain protein 6" [A 1.0 0.360 0.682 7.9e-30
TAIR|locus:2059883 269 MYB7 "myb domain protein 7" [A 1.0 0.315 0.670 1e-29
TAIR|locus:2145648 MYB40 "myb domain protein 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 428 (155.7 bits), Expect = 3.3e-40, P = 3.3e-40
 Identities = 73/85 (85%), Positives = 82/85 (96%)

Query:     1 MGRQPCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINY 60
             MGR+PCCDK+GLKRGPWTIEEDH+LM+FILNNGIHCWR+VPKLAGLLRCGKSCRLRWINY
Sbjct:     1 MGRKPCCDKIGLKRGPWTIEEDHRLMNFILNNGIHCWRIVPKLAGLLRCGKSCRLRWINY 60

Query:    61 LRPDLKRGAFTEDEEDQIIQLHSLL 85
             LRPDLKRG FT+ EED+I++LHS L
Sbjct:    61 LRPDLKRGGFTDAEEDRIMELHSQL 85
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2174195 MYB43 "myb domain protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205283 MYB20 "myb domain protein 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132584 MYB85 "myb domain protein 85" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086233 MYB15 "myb domain protein 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139144 MYB42 "myb domain protein 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098906 MYB17 "myb domain protein 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038520 MYB13 "myb domain protein 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133677 MYB6 "myb domain protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059883 MYB7 "myb domain protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query85
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 8e-41
PLN03212 249 PLN03212, PLN03212, Transcription repressor MYB5; 6e-37
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 3e-11
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 1e-08
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 9e-08
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 4e-05
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 3e-04
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information 
 Score =  138 bits (349), Expect = 8e-41
 Identities = 53/85 (62%), Positives = 63/85 (74%)

Query: 1  MGRQPCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINY 60
          MGR  CC K  L++G W+ EED KL+  I   G  CW  VPK AGL RCGKSCRLRWINY
Sbjct: 1  MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINY 60

Query: 61 LRPDLKRGAFTEDEEDQIIQLHSLL 85
          LRPDLKRG F++ EE+ II+LH++L
Sbjct: 61 LRPDLKRGTFSQQEENLIIELHAVL 85

Length = 459
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 85
PLN03091 459 hypothetical protein; Provisional 99.98
PLN03212 249 Transcription repressor MYB5; Provisional 99.97
KOG0048 238 consensus Transcription factor, Myb superfamily [T 99.95
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.89
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.81
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.79
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.66
PLN03212 249 Transcription repressor MYB5; Provisional 99.62
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.59
KOG0051 607 consensus RNA polymerase I termination factor, Myb 99.59
PLN03091 459 hypothetical protein; Provisional 99.59
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.5
KOG0048 238 consensus Transcription factor, Myb superfamily [T 99.46
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.45
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.44
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.94
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.91
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.85
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 98.59
KOG0051607 consensus RNA polymerase I termination factor, Myb 98.3
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 98.24
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 98.22
KOG1279 506 consensus Chromatin remodeling factor subunit and 98.15
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 98.14
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.92
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 97.86
PRK13923170 putative spore coat protein regulator protein YlbO 97.6
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 97.56
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 97.39
PF13325 199 MCRS_N: N-terminal region of micro-spherule protei 97.01
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 96.6
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 96.41
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 96.23
KOG4282 345 consensus Transcription factor GT-2 and related pr 96.09
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 95.96
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 95.71
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 95.69
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 95.63
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 94.42
KOG2656 445 consensus DNA methyltransferase 1-associated prote 93.84
PRK11169164 leucine-responsive transcriptional regulator; Prov 93.65
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 91.96
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 91.1
KOG4167 907 consensus Predicted DNA-binding protein, contains 90.03
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 89.99
PF0138892 ARID: ARID/BRIGHT DNA binding domain; InterPro: IP 88.96
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 88.67
smart0059589 MADF subfamily of SANT domain. 88.55
smart0050193 BRIGHT BRIGHT, ARID (A/T-rich interaction domain) 87.67
PLN031421033 Probable chromatin-remodeling complex ATPase chain 87.53
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 87.14
COG1522154 Lrp Transcriptional regulators [Transcription] 86.86
PF1054585 MADF_DNA_bdg: Alcohol dehydrogenase transcription 86.84
KOG1194 534 consensus Predicted DNA-binding protein, contains 86.78
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 84.76
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 84.56
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 82.56
KOG4468 782 consensus Polycomb-group transcriptional regulator 81.76
cd0831983 Death_RAIDD Death domain of RIP-associated ICH-1 h 81.64
KOG2009 584 consensus Transcription initiation factor TFIIIB, 81.03
PF07750162 GcrA: GcrA cell cycle regulator; InterPro: IPR0116 80.64
cd0880384 Death_ank3 Death domain of Ankyrin-3. Death Domain 80.29
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information 
Probab=99.98  E-value=1.5e-32  Score=199.05  Aligned_cols=85  Identities=62%  Similarity=1.208  Sum_probs=82.1

Q ss_pred             CCCCCCCCCCCCCcCCCCHHHHHHHHHHHHHhCCCCchhhhhhhCCCCchhhHHHHHHhhhCCCCCCCCCCHHHHHHHHH
Q 041165            1 MGRQPCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPDLKRGAFTEDEEDQIIQ   80 (85)
Q Consensus         1 m~r~~~~~k~~~~kg~WT~eED~~L~~~v~~~g~~~W~~Ia~~~~~~Rt~~qcr~Rw~~~l~~~~~~~~wt~eEd~~L~~   80 (85)
                      |||++||+|..++||+||+|||++|+++|.+||..+|..||+.++.+|+++|||+||.++|+|.+++++||+|||.+|++
T Consensus         1 mgr~~Cc~KqklrKg~WTpEEDe~L~~~V~kyG~~nWs~IAk~~g~gRT~KQCRERW~NyLdP~IkKgpWT~EED~lLLe   80 (459)
T PLN03091          1 MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLIIE   80 (459)
T ss_pred             CCCCccCcCCCCcCCCCCHHHHHHHHHHHHHhCcCCHHHHhhhhccCcCcchHhHHHHhccCCcccCCCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999998756999999999999999999999999999999999


Q ss_pred             HHHhC
Q 041165           81 LHSLL   85 (85)
Q Consensus        81 ~v~~~   85 (85)
                      +|++|
T Consensus        81 L~k~~   85 (459)
T PLN03091         81 LHAVL   85 (459)
T ss_pred             HHHHh
Confidence            99875

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF01388 ARID: ARID/BRIGHT DNA binding domain; InterPro: IPR001606 Members of the recently discovered ARID (AT-rich interaction domain; also known as BRIGHT domain)) family of DNA-binding proteins are found in fungi and invertebrate and vertebrate metazoans Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>smart00595 MADF subfamily of SANT domain Back     alignment and domain information
>smart00501 BRIGHT BRIGHT, ARID (A/T-rich interaction domain) domain Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>PF10545 MADF_DNA_bdg: Alcohol dehydrogenase transcription factor Myb/SANT-like; InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>cd08319 Death_RAIDD Death domain of RIP-associated ICH-1 homologous protein with a death domain Back     alignment and domain information
>KOG2009 consensus Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF07750 GcrA: GcrA cell cycle regulator; InterPro: IPR011681 GcrA, together with CtrA (see IPR001789 from INTERPRO and IPR001867 from INTERPRO), form a master cell cycle regulator Back     alignment and domain information
>cd08803 Death_ank3 Death domain of Ankyrin-3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query85
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 2e-11
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 2e-10
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 3e-10
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 3e-10
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 3e-10
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 4e-06
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 9e-06
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 1e-05
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 2e-05
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure 
Iteration: 1

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 3/75 (4%)
Query: 12 LKRGPWTIEEDHKLMSFILNNGIHCWRMVPK-LAGLLRCGKSCRLRWINYLRPDLKRGAF 70
          L +GPWT EED K++  +   G   W ++ K L G  R GK CR RW N+L P++K+ ++
Sbjct: 5  LVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKG--RLGKQCRERWHNHLNPEVKKSSW 62
Query: 71 TEDEEDQIIQLHSLL 85
          TE+E+  I + H +L
Sbjct: 63 TEEEDRIIFEAHKVL 77
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query85
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 2e-37
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 8e-36
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 3e-12
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 1e-35
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 2e-30
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 5e-29
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-22
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-04
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 4e-28
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 4e-23
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-22
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 3e-17
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 6e-13
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 5e-08
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 5e-06
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 1e-05
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 2e-04
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 8e-04
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
 Score =  119 bits (302), Expect = 2e-37
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 12 LKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPDLKRGAFT 71
          L +GPWT EED +++  +   G   W ++ K     R GK CR RW N+L P++K+ ++T
Sbjct: 2  LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWT 60

Query: 72 EDEEDQIIQLHSLL 85
          E+E+  I Q H  L
Sbjct: 61 EEEDRIIYQAHKRL 74
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query85
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.96
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.96
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.96
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.96
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.96
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.96
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.95
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.93
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.91
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.9
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.89
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.89
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.87
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.87
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.87
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.87
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.86
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.85
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.84
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.84
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.84
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.83
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.8
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.78
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.78
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.77
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.75
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.74
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.73
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.73
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.57
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.72
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.71
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.56
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.48
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.4
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.36
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 99.17
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.16
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 99.12
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 98.9
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.78
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.74
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.72
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.67
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.65
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 98.45
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 98.43
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.77
2crg_A70 Metastasis associated protein MTA3; transcription 98.35
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.34
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 98.22
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 98.1
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 98.02
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 98.02
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 97.95
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 97.95
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 97.93
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 97.9
1ofc_X 304 ISWI protein; nuclear protein, chromatin remodelin 97.89
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 97.85
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 97.83
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 97.8
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 97.76
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 96.66
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 97.5
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.37
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.32
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 97.26
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 97.2
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 97.16
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 97.15
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 97.11
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 97.04
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 96.77
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 96.72
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.35
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 96.32
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 96.2
4b4c_A 211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.1
2y9y_A 374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.07
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 95.69
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 95.28
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 93.87
2rq5_A121 Protein jumonji; developmental protein, nucleus, r 92.93
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 92.37
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 92.23
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 92.16
2li6_A116 SWI/SNF chromatin-remodeling complex subunit SWI1; 91.92
1ig6_A107 MRF-2, modulator recognition factor 2; DNA binding 90.49
2jrz_A117 Histone demethylase jarid1C; bright/ARID domain, h 88.83
2kk0_A145 AT-rich interactive domain-containing protein 3A; 88.75
2lm1_A107 Lysine-specific demethylase LID; structural genomi 88.72
1c20_A128 DEAD ringer protein; DNA-binding domain, ARID, AT- 88.56
3i4p_A162 Transcriptional regulator, ASNC family; PSI, struc 88.29
2cxy_A125 BAF250B subunit, HBAF250B; DNA-binding domain, str 86.96
2eqy_A122 RBP2 like, jumonji, at rich interactive domain 1B; 85.35
1kkx_A123 Transcription regulatory protein ADR6; ARID, DNA-b 85.32
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 84.73
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 84.28
2jxj_A96 Histone demethylase jarid1A; ARID domain, chromati 83.73
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 82.02
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 81.69
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 81.48
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 80.75
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
Probab=99.96  E-value=4.4e-30  Score=160.53  Aligned_cols=81  Identities=36%  Similarity=0.635  Sum_probs=73.1

Q ss_pred             CCCCCCCCCCcCCCCHHHHHHHHHHHHHhCCCCchhhhhhhCCCCchhhHHHHHHhhhCCCCCCCCCCHHHHHHHHHHHH
Q 041165            4 QPCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPDLKRGAFTEDEEDQIIQLHS   83 (85)
Q Consensus         4 ~~~~~k~~~~kg~WT~eED~~L~~~v~~~g~~~W~~Ia~~~~~~Rt~~qcr~Rw~~~l~~~~~~~~wt~eEd~~L~~~v~   83 (85)
                      .....+|++++|+||+|||++|+++|+.||.++|..||..|++ ||+.||++||.++|+|.+++++||+|||.+|+++|+
T Consensus        17 w~~~l~p~~~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l~~-Rt~~qcr~Rw~~~l~p~~~~~~WT~eEd~~L~~~~~   95 (128)
T 1h8a_C           17 WQKVLNPELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHK   95 (128)
T ss_dssp             -----CTTCCCSCCCHHHHHHHHHHHHHTCSCCHHHHHHHSSS-CCHHHHHHHHHHTTCSSSCCSCCCHHHHHHHHHHHH
T ss_pred             HHHhhCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHhcC-CcHHHHHHHHHHhcccccccccCCHHHHHHHHHHHH
Confidence            3445779999999999999999999999998789999999994 999999999999999999999999999999999998


Q ss_pred             hC
Q 041165           84 LL   85 (85)
Q Consensus        84 ~~   85 (85)
                      +|
T Consensus        96 ~~   97 (128)
T 1h8a_C           96 RL   97 (128)
T ss_dssp             HH
T ss_pred             HH
Confidence            64
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2rq5_A Protein jumonji; developmental protein, nucleus, repressor, transcription, transcription regulation; NMR {Mus musculus} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2li6_A SWI/SNF chromatin-remodeling complex subunit SWI1; ligand binding, DNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ig6_A MRF-2, modulator recognition factor 2; DNA binding protein, DNA-binding motif, protein-DNA interaction; NMR {Homo sapiens} SCOP: a.4.3.1 PDB: 2oeh_A Back     alignment and structure
>2jrz_A Histone demethylase jarid1C; bright/ARID domain, helical, structural genomics, structural genomics consortium, SGC, oxidoreductase; NMR {Homo sapiens} PDB: 2yqe_A Back     alignment and structure
>2kk0_A AT-rich interactive domain-containing protein 3A; DEAD ringer, AT-rich interaction domain, NESG, ARID, cytopla binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2lm1_A Lysine-specific demethylase LID; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>1c20_A DEAD ringer protein; DNA-binding domain, ARID, AT-rich interaction domain, DNA- binding protein; NMR {Drosophila melanogaster} SCOP: a.4.3.1 PDB: 1kqq_A Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2cxy_A BAF250B subunit, HBAF250B; DNA-binding domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.60A {Homo sapiens} PDB: 2eh9_A 1ryu_A Back     alignment and structure
>2eqy_A RBP2 like, jumonji, at rich interactive domain 1B; ARID domain, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1kkx_A Transcription regulatory protein ADR6; ARID, DNA-binding domain, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.4.3.1 PDB: 1kn5_A Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2jxj_A Histone demethylase jarid1A; ARID domain, chromatin regulator, developmental protein, dioxygenase, iron, metal-binding, nucleus, oxidoreductase; NMR {Homo sapiens} Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 85
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 7e-20
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 7e-18
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 5e-17
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 4e-14
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 5e-14
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 2e-13
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 7e-12
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 1e-11
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-10
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 3e-08
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 5e-07
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 4e-06
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 72.8 bits (179), Expect = 7e-20
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 12 LKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPD 64
          L +GPWT EED +L+  +   G   W ++ K     R GK CR RW N+L P+
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query85
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.92
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.92
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.9
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.84
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.83
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.81
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.81
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.8
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.74
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.74
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.67
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.56
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.54
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.47
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.82
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.8
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 98.24
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.14
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.94
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 97.91
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 97.88
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 97.86
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 97.66
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.65
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 97.57
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.44
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 96.97
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 96.54
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 95.75
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 95.53
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 95.43
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 95.27
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 95.06
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 93.21
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 93.13
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 93.04
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.22
d1ig6a_107 MRF-2 DNA-binding domain {Human (Homo sapiens) [Ta 89.38
d1kkxa_102 Transcription regulator Adr6 (Swi1) {Baker's yeast 88.88
d1ryua_120 SWI-SNF complex protein p270, SMARCF1 {Human (Homo 88.39
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 87.54
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 86.19
d1c20a_128 DNA-binding domain from the dead ringer protein {F 85.91
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.92  E-value=4.1e-26  Score=122.05  Aligned_cols=52  Identities=42%  Similarity=0.862  Sum_probs=49.6

Q ss_pred             CCcCCCCHHHHHHHHHHHHHhCCCCchhhhhhhCCCCchhhHHHHHHhhhCCC
Q 041165           12 LKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPD   64 (85)
Q Consensus        12 ~~kg~WT~eED~~L~~~v~~~g~~~W~~Ia~~~~~~Rt~~qcr~Rw~~~l~~~   64 (85)
                      |+||+||+|||++|+++|.+||.++|..||+.|+ +||+.||++||.++|+|+
T Consensus         1 l~rg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qc~~Rw~~~L~P~   52 (52)
T d1gvda_           1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE   52 (52)
T ss_dssp             CCCCSCCHHHHHHHHHHHHHHCTTCHHHHHTTST-TCCHHHHHHHHHHTTSCC
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHC-CCCHHHHHHHHHhhCCCC
Confidence            5799999999999999999999889999999999 599999999999999984
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ig6a_ a.4.3.1 (A:) MRF-2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkxa_ a.4.3.1 (A:) Transcription regulator Adr6 (Swi1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryua_ a.4.3.1 (A:) SWI-SNF complex protein p270, SMARCF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c20a_ a.4.3.1 (A:) DNA-binding domain from the dead ringer protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure