Citrus Sinensis ID: 041165
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 85 | ||||||
| 356573735 | 273 | PREDICTED: myb-related protein 315-like | 1.0 | 0.311 | 0.941 | 5e-41 | |
| 296081315 | 405 | unnamed protein product [Vitis vinifera] | 1.0 | 0.209 | 0.929 | 6e-41 | |
| 255571980 | 242 | r2r3-myb transcription factor, putative | 1.0 | 0.351 | 0.929 | 7e-41 | |
| 356560528 | 276 | PREDICTED: myb-related protein 315-like | 1.0 | 0.307 | 0.929 | 9e-41 | |
| 359488652 | 268 | PREDICTED: myb-related protein 315-like | 1.0 | 0.317 | 0.929 | 1e-40 | |
| 449492951 | 305 | PREDICTED: protein ODORANT1-like [Cucumi | 1.0 | 0.278 | 0.917 | 2e-40 | |
| 224055659 | 282 | predicted protein [Populus trichocarpa] | 1.0 | 0.301 | 0.894 | 2e-39 | |
| 356513834 | 273 | PREDICTED: myb-related protein 315-like | 1.0 | 0.311 | 0.894 | 4e-39 | |
| 255547912 | 146 | r2r3-myb transcription factor, putative | 1.0 | 0.582 | 0.905 | 7e-39 | |
| 15241377 | 263 | myb domain protein 40 [Arabidopsis thali | 1.0 | 0.323 | 0.858 | 1e-38 |
| >gi|356573735|ref|XP_003555012.1| PREDICTED: myb-related protein 315-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 171 bits (433), Expect = 5e-41, Method: Compositional matrix adjust.
Identities = 80/85 (94%), Positives = 81/85 (95%)
Query: 1 MGRQPCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINY 60
MGRQPCCDKVGLKRGPWTIEEDHKLM+FILNNGIHCWR VPKLAGLLRCGKSCRLRWINY
Sbjct: 1 MGRQPCCDKVGLKRGPWTIEEDHKLMNFILNNGIHCWRTVPKLAGLLRCGKSCRLRWINY 60
Query: 61 LRPDLKRGAFTEDEEDQIIQLHSLL 85
LRPDLKRG FTE EEDQIIQLHS L
Sbjct: 61 LRPDLKRGGFTEMEEDQIIQLHSCL 85
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296081315|emb|CBI17697.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255571980|ref|XP_002526931.1| r2r3-myb transcription factor, putative [Ricinus communis] gi|223533683|gb|EEF35418.1| r2r3-myb transcription factor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356560528|ref|XP_003548543.1| PREDICTED: myb-related protein 315-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359488652|ref|XP_002271033.2| PREDICTED: myb-related protein 315-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449492951|ref|XP_004159150.1| PREDICTED: protein ODORANT1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224055659|ref|XP_002298589.1| predicted protein [Populus trichocarpa] gi|222845847|gb|EEE83394.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356513834|ref|XP_003525613.1| PREDICTED: myb-related protein 315-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255547912|ref|XP_002515013.1| r2r3-myb transcription factor, putative [Ricinus communis] gi|223546064|gb|EEF47567.1| r2r3-myb transcription factor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|15241377|ref|NP_196938.1| myb domain protein 40 [Arabidopsis thaliana] gi|7573459|emb|CAB87773.1| MYB40-putative transcription factor [Arabidopsis thaliana] gi|41619392|gb|AAS10092.1| MYB transcription factor [Arabidopsis thaliana] gi|332004636|gb|AED92019.1| myb domain protein 40 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 85 | ||||||
| TAIR|locus:2145648 | 263 | MYB40 "myb domain protein 40" | 1.0 | 0.323 | 0.858 | 3.3e-40 | |
| TAIR|locus:2174195 | 327 | MYB43 "myb domain protein 43" | 1.0 | 0.259 | 0.764 | 4.6e-34 | |
| TAIR|locus:2205283 | 282 | MYB20 "myb domain protein 20" | 1.0 | 0.301 | 0.752 | 3.2e-33 | |
| TAIR|locus:2132584 | 266 | MYB85 "myb domain protein 85" | 1.0 | 0.319 | 0.717 | 1.8e-32 | |
| TAIR|locus:2086233 | 285 | MYB15 "myb domain protein 15" | 1.0 | 0.298 | 0.717 | 1.3e-31 | |
| TAIR|locus:2139144 | 286 | MYB42 "myb domain protein 42" | 1.0 | 0.297 | 0.705 | 3.3e-31 | |
| TAIR|locus:2098906 | 299 | MYB17 "myb domain protein 17" | 1.0 | 0.284 | 0.705 | 4.2e-31 | |
| TAIR|locus:2038520 | 246 | MYB13 "myb domain protein 13" | 1.0 | 0.345 | 0.694 | 3.8e-30 | |
| TAIR|locus:2133677 | 236 | MYB6 "myb domain protein 6" [A | 1.0 | 0.360 | 0.682 | 7.9e-30 | |
| TAIR|locus:2059883 | 269 | MYB7 "myb domain protein 7" [A | 1.0 | 0.315 | 0.670 | 1e-29 |
| TAIR|locus:2145648 MYB40 "myb domain protein 40" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 428 (155.7 bits), Expect = 3.3e-40, P = 3.3e-40
Identities = 73/85 (85%), Positives = 82/85 (96%)
Query: 1 MGRQPCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINY 60
MGR+PCCDK+GLKRGPWTIEEDH+LM+FILNNGIHCWR+VPKLAGLLRCGKSCRLRWINY
Sbjct: 1 MGRKPCCDKIGLKRGPWTIEEDHRLMNFILNNGIHCWRIVPKLAGLLRCGKSCRLRWINY 60
Query: 61 LRPDLKRGAFTEDEEDQIIQLHSLL 85
LRPDLKRG FT+ EED+I++LHS L
Sbjct: 61 LRPDLKRGGFTDAEEDRIMELHSQL 85
|
|
| TAIR|locus:2174195 MYB43 "myb domain protein 43" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205283 MYB20 "myb domain protein 20" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132584 MYB85 "myb domain protein 85" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2086233 MYB15 "myb domain protein 15" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2139144 MYB42 "myb domain protein 42" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098906 MYB17 "myb domain protein 17" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2038520 MYB13 "myb domain protein 13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2133677 MYB6 "myb domain protein 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2059883 MYB7 "myb domain protein 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 85 | |||
| PLN03091 | 459 | PLN03091, PLN03091, hypothetical protein; Provisio | 8e-41 | |
| PLN03212 | 249 | PLN03212, PLN03212, Transcription repressor MYB5; | 6e-37 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 3e-11 | |
| COG5147 | 512 | COG5147, REB1, Myb superfamily proteins, including | 1e-08 | |
| pfam13921 | 59 | pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do | 9e-08 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 4e-05 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 3e-04 |
| >gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Score = 138 bits (349), Expect = 8e-41
Identities = 53/85 (62%), Positives = 63/85 (74%)
Query: 1 MGRQPCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINY 60
MGR CC K L++G W+ EED KL+ I G CW VPK AGL RCGKSCRLRWINY
Sbjct: 1 MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINY 60
Query: 61 LRPDLKRGAFTEDEEDQIIQLHSLL 85
LRPDLKRG F++ EE+ II+LH++L
Sbjct: 61 LRPDLKRGTFSQQEENLIIELHAVL 85
|
Length = 459 |
| >gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 85 | |||
| PLN03091 | 459 | hypothetical protein; Provisional | 99.98 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 99.97 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 99.95 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.89 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.81 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.79 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.66 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 99.62 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.59 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 99.59 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 99.59 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 99.5 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 99.46 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 99.45 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 99.44 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 98.94 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 98.91 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 98.85 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 98.59 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 98.3 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 98.24 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 98.22 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 98.15 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 98.14 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 97.92 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 97.86 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 97.6 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 97.56 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 97.39 | |
| PF13325 | 199 | MCRS_N: N-terminal region of micro-spherule protei | 97.01 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 96.6 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 96.41 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 96.23 | |
| KOG4282 | 345 | consensus Transcription factor GT-2 and related pr | 96.09 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 95.96 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 95.71 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 95.69 | |
| PF13404 | 42 | HTH_AsnC-type: AsnC-type helix-turn-helix domain; | 95.63 | |
| PRK11179 | 153 | DNA-binding transcriptional regulator AsnC; Provis | 94.42 | |
| KOG2656 | 445 | consensus DNA methyltransferase 1-associated prote | 93.84 | |
| PRK11169 | 164 | leucine-responsive transcriptional regulator; Prov | 93.65 | |
| PF08281 | 54 | Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 | 91.96 | |
| PF11626 | 87 | Rap1_C: TRF2-interacting telomeric protein/Rap1 - | 91.1 | |
| KOG4167 | 907 | consensus Predicted DNA-binding protein, contains | 90.03 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 89.99 | |
| PF01388 | 92 | ARID: ARID/BRIGHT DNA binding domain; InterPro: IP | 88.96 | |
| smart00344 | 108 | HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto | 88.67 | |
| smart00595 | 89 | MADF subfamily of SANT domain. | 88.55 | |
| smart00501 | 93 | BRIGHT BRIGHT, ARID (A/T-rich interaction domain) | 87.67 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 87.53 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 87.14 | |
| COG1522 | 154 | Lrp Transcriptional regulators [Transcription] | 86.86 | |
| PF10545 | 85 | MADF_DNA_bdg: Alcohol dehydrogenase transcription | 86.84 | |
| KOG1194 | 534 | consensus Predicted DNA-binding protein, contains | 86.78 | |
| PF13325 | 199 | MCRS_N: N-terminal region of micro-spherule protei | 84.76 | |
| PF04545 | 50 | Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 | 84.56 | |
| KOG0384 | 1373 | consensus Chromodomain-helicase DNA-binding protei | 82.56 | |
| KOG4468 | 782 | consensus Polycomb-group transcriptional regulator | 81.76 | |
| cd08319 | 83 | Death_RAIDD Death domain of RIP-associated ICH-1 h | 81.64 | |
| KOG2009 | 584 | consensus Transcription initiation factor TFIIIB, | 81.03 | |
| PF07750 | 162 | GcrA: GcrA cell cycle regulator; InterPro: IPR0116 | 80.64 | |
| cd08803 | 84 | Death_ank3 Death domain of Ankyrin-3. Death Domain | 80.29 |
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Probab=99.98 E-value=1.5e-32 Score=199.05 Aligned_cols=85 Identities=62% Similarity=1.208 Sum_probs=82.1
Q ss_pred CCCCCCCCCCCCCcCCCCHHHHHHHHHHHHHhCCCCchhhhhhhCCCCchhhHHHHHHhhhCCCCCCCCCCHHHHHHHHH
Q 041165 1 MGRQPCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPDLKRGAFTEDEEDQIIQ 80 (85)
Q Consensus 1 m~r~~~~~k~~~~kg~WT~eED~~L~~~v~~~g~~~W~~Ia~~~~~~Rt~~qcr~Rw~~~l~~~~~~~~wt~eEd~~L~~ 80 (85)
|||++||+|..++||+||+|||++|+++|.+||..+|..||+.++.+|+++|||+||.++|+|.+++++||+|||.+|++
T Consensus 1 mgr~~Cc~KqklrKg~WTpEEDe~L~~~V~kyG~~nWs~IAk~~g~gRT~KQCRERW~NyLdP~IkKgpWT~EED~lLLe 80 (459)
T PLN03091 1 MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLIIE 80 (459)
T ss_pred CCCCccCcCCCCcCCCCCHHHHHHHHHHHHHhCcCCHHHHhhhhccCcCcchHhHHHHhccCCcccCCCCCHHHHHHHHH
Confidence 99999999999999999999999999999999999999999998756999999999999999999999999999999999
Q ss_pred HHHhC
Q 041165 81 LHSLL 85 (85)
Q Consensus 81 ~v~~~ 85 (85)
+|++|
T Consensus 81 L~k~~ 85 (459)
T PLN03091 81 LHAVL 85 (459)
T ss_pred HHHHh
Confidence 99875
|
|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >PF13325 MCRS_N: N-terminal region of micro-spherule protein | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B | Back alignment and domain information |
|---|
| >PRK11179 DNA-binding transcriptional regulator AsnC; Provisional | Back alignment and domain information |
|---|
| >KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >PRK11169 leucine-responsive transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] | Back alignment and domain information |
|---|
| >KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >PF01388 ARID: ARID/BRIGHT DNA binding domain; InterPro: IPR001606 Members of the recently discovered ARID (AT-rich interaction domain; also known as BRIGHT domain)) family of DNA-binding proteins are found in fungi and invertebrate and vertebrate metazoans | Back alignment and domain information |
|---|
| >smart00344 HTH_ASNC helix_turn_helix ASNC type | Back alignment and domain information |
|---|
| >smart00595 MADF subfamily of SANT domain | Back alignment and domain information |
|---|
| >smart00501 BRIGHT BRIGHT, ARID (A/T-rich interaction domain) domain | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >COG1522 Lrp Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PF10545 MADF_DNA_bdg: Alcohol dehydrogenase transcription factor Myb/SANT-like; InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats | Back alignment and domain information |
|---|
| >KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >PF13325 MCRS_N: N-terminal region of micro-spherule protein | Back alignment and domain information |
|---|
| >PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >cd08319 Death_RAIDD Death domain of RIP-associated ICH-1 homologous protein with a death domain | Back alignment and domain information |
|---|
| >KOG2009 consensus Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >PF07750 GcrA: GcrA cell cycle regulator; InterPro: IPR011681 GcrA, together with CtrA (see IPR001789 from INTERPRO and IPR001867 from INTERPRO), form a master cell cycle regulator | Back alignment and domain information |
|---|
| >cd08803 Death_ank3 Death domain of Ankyrin-3 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 85 | ||||
| 1a5j_A | 110 | Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe | 2e-11 | ||
| 1gv2_A | 105 | Crystal Structure Of C-Myb R2r3 Length = 105 | 2e-10 | ||
| 1mse_C | 105 | Solution Structure Of A Specific Dna Complex Of The | 3e-10 | ||
| 1h88_C | 159 | Crystal Structure Of Ternary Protein-Dna Complex1 L | 3e-10 | ||
| 1h8a_C | 128 | Crystal Structure Of Ternary Protein-Dna Complex3 L | 3e-10 | ||
| 3zqc_A | 131 | Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin | 4e-06 | ||
| 1gvd_A | 52 | Crystal Structure Of C-Myb R2 V103l Mutant Length = | 9e-06 | ||
| 1mbg_A | 53 | Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 | 1e-05 | ||
| 1gv5_A | 52 | Crystal Structure Of C-Myb R2 Length = 52 | 2e-05 |
| >pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 | Back alignment and structure |
|
| >pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 | Back alignment and structure |
| >pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 | Back alignment and structure |
| >pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 | Back alignment and structure |
| >pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 | Back alignment and structure |
| >pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 | Back alignment and structure |
| >pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 | Back alignment and structure |
| >pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 | Back alignment and structure |
| >pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 85 | |||
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 2e-37 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 8e-36 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 3e-12 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 1e-35 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 2e-30 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 5e-29 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 1e-22 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 1e-04 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 4e-28 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 4e-23 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 2e-22 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 3e-17 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 6e-13 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 5e-08 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 5e-06 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 1e-05 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 2e-04 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 8e-04 |
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 | Back alignment and structure |
|---|
Score = 119 bits (302), Expect = 2e-37
Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
Query: 12 LKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPDLKRGAFT 71
L +GPWT EED +++ + G W ++ K R GK CR RW N+L P++K+ ++T
Sbjct: 2 LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWT 60
Query: 72 EDEEDQIIQLHSLL 85
E+E+ I Q H L
Sbjct: 61 EEEDRIIYQAHKRL 74
|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 85 | |||
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.96 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.96 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.96 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.96 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.96 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.96 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.95 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.93 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.91 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.9 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.89 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.89 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.87 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 99.87 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.87 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 99.87 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.86 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.85 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.84 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.84 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.84 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.83 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.8 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 99.78 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 99.78 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 99.77 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.75 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.74 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.73 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.73 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 99.57 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.72 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.71 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.56 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 99.48 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 99.4 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 99.36 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 99.17 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 99.16 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 99.12 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 98.9 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 98.78 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 98.74 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 98.72 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 98.67 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 98.65 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 98.45 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 98.43 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 97.77 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 98.35 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 98.34 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 98.22 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 98.1 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 98.02 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 98.02 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 97.95 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 97.95 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 97.93 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 97.9 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 97.89 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 97.85 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 97.83 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 97.8 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 97.76 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 96.66 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 97.5 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.37 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 97.32 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 97.26 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 97.2 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 97.16 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 97.15 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 97.11 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 97.04 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 96.77 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 96.72 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 96.35 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 96.32 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 96.2 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 96.1 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 96.07 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 95.69 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 95.28 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 93.87 | |
| 2rq5_A | 121 | Protein jumonji; developmental protein, nucleus, r | 92.93 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 92.37 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 92.23 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 92.16 | |
| 2li6_A | 116 | SWI/SNF chromatin-remodeling complex subunit SWI1; | 91.92 | |
| 1ig6_A | 107 | MRF-2, modulator recognition factor 2; DNA binding | 90.49 | |
| 2jrz_A | 117 | Histone demethylase jarid1C; bright/ARID domain, h | 88.83 | |
| 2kk0_A | 145 | AT-rich interactive domain-containing protein 3A; | 88.75 | |
| 2lm1_A | 107 | Lysine-specific demethylase LID; structural genomi | 88.72 | |
| 1c20_A | 128 | DEAD ringer protein; DNA-binding domain, ARID, AT- | 88.56 | |
| 3i4p_A | 162 | Transcriptional regulator, ASNC family; PSI, struc | 88.29 | |
| 2cxy_A | 125 | BAF250B subunit, HBAF250B; DNA-binding domain, str | 86.96 | |
| 2eqy_A | 122 | RBP2 like, jumonji, at rich interactive domain 1B; | 85.35 | |
| 1kkx_A | 123 | Transcription regulatory protein ADR6; ARID, DNA-b | 85.32 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 84.73 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 84.28 | |
| 2jxj_A | 96 | Histone demethylase jarid1A; ARID domain, chromati | 83.73 | |
| 2p1m_A | 160 | SKP1-like protein 1A; F-BOX, leucine rich repeat, | 82.02 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 81.69 | |
| 3v7d_A | 169 | Suppressor of kinetochore protein 1; WD 40 domain, | 81.48 | |
| 2e1c_A | 171 | Putative HTH-type transcriptional regulator PH151; | 80.75 |
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
Probab=99.96 E-value=4.4e-30 Score=160.53 Aligned_cols=81 Identities=36% Similarity=0.635 Sum_probs=73.1
Q ss_pred CCCCCCCCCCcCCCCHHHHHHHHHHHHHhCCCCchhhhhhhCCCCchhhHHHHHHhhhCCCCCCCCCCHHHHHHHHHHHH
Q 041165 4 QPCCDKVGLKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPDLKRGAFTEDEEDQIIQLHS 83 (85)
Q Consensus 4 ~~~~~k~~~~kg~WT~eED~~L~~~v~~~g~~~W~~Ia~~~~~~Rt~~qcr~Rw~~~l~~~~~~~~wt~eEd~~L~~~v~ 83 (85)
.....+|++++|+||+|||++|+++|+.||.++|..||..|++ ||+.||++||.++|+|.+++++||+|||.+|+++|+
T Consensus 17 w~~~l~p~~~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l~~-Rt~~qcr~Rw~~~l~p~~~~~~WT~eEd~~L~~~~~ 95 (128)
T 1h8a_C 17 WQKVLNPELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHK 95 (128)
T ss_dssp -----CTTCCCSCCCHHHHHHHHHHHHHTCSCCHHHHHHHSSS-CCHHHHHHHHHHTTCSSSCCSCCCHHHHHHHHHHHH
T ss_pred HHHhhCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHhcC-CcHHHHHHHHHHhcccccccccCCHHHHHHHHHHHH
Confidence 3445779999999999999999999999998789999999994 999999999999999999999999999999999998
Q ss_pred hC
Q 041165 84 LL 85 (85)
Q Consensus 84 ~~ 85 (85)
+|
T Consensus 96 ~~ 97 (128)
T 1h8a_C 96 RL 97 (128)
T ss_dssp HH
T ss_pred HH
Confidence 64
|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >2rq5_A Protein jumonji; developmental protein, nucleus, repressor, transcription, transcription regulation; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2li6_A SWI/SNF chromatin-remodeling complex subunit SWI1; ligand binding, DNA binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ig6_A MRF-2, modulator recognition factor 2; DNA binding protein, DNA-binding motif, protein-DNA interaction; NMR {Homo sapiens} SCOP: a.4.3.1 PDB: 2oeh_A | Back alignment and structure |
|---|
| >2jrz_A Histone demethylase jarid1C; bright/ARID domain, helical, structural genomics, structural genomics consortium, SGC, oxidoreductase; NMR {Homo sapiens} PDB: 2yqe_A | Back alignment and structure |
|---|
| >2kk0_A AT-rich interactive domain-containing protein 3A; DEAD ringer, AT-rich interaction domain, NESG, ARID, cytopla binding, nucleus, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lm1_A Lysine-specific demethylase LID; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1c20_A DEAD ringer protein; DNA-binding domain, ARID, AT-rich interaction domain, DNA- binding protein; NMR {Drosophila melanogaster} SCOP: a.4.3.1 PDB: 1kqq_A | Back alignment and structure |
|---|
| >3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2cxy_A BAF250B subunit, HBAF250B; DNA-binding domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.60A {Homo sapiens} PDB: 2eh9_A 1ryu_A | Back alignment and structure |
|---|
| >2eqy_A RBP2 like, jumonji, at rich interactive domain 1B; ARID domain, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1kkx_A Transcription regulatory protein ADR6; ARID, DNA-binding domain, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.4.3.1 PDB: 1kn5_A | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >2jxj_A Histone demethylase jarid1A; ARID domain, chromatin regulator, developmental protein, dioxygenase, iron, metal-binding, nucleus, oxidoreductase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 85 | ||||
| d1gvda_ | 52 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 7e-20 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 7e-18 | |
| d1igna1 | 86 | a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba | 5e-17 | |
| d1w0ua_ | 55 | a.4.1.4 (A:) Telomeric repeat binding factor 2, TR | 4e-14 | |
| d2ckxa1 | 83 | a.4.1.3 (A:578-660) Telomere binding protein TBP1 | 5e-14 | |
| d1w0ta_ | 52 | a.4.1.4 (A:) DNA-binding domain of human telomeric | 2e-13 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 7e-12 | |
| d1gv2a2 | 47 | a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou | 1e-11 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 1e-10 | |
| d1x41a1 | 47 | a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T | 3e-08 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 5e-07 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 4e-06 |
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: c-Myb, DNA-binding domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 72.8 bits (179), Expect = 7e-20
Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
Query: 12 LKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPD 64
L +GPWT EED +L+ + G W ++ K R GK CR RW N+L P+
Sbjct: 1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 85 | |||
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.92 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.92 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.9 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.84 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.83 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.81 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 99.81 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.8 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.74 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.74 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.67 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.56 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 99.54 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 99.47 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 98.82 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 98.8 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 98.24 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.14 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 97.94 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 97.91 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 97.88 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 97.86 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 97.66 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 97.65 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 97.57 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 97.44 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 96.97 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 96.54 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 95.75 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 95.53 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 95.43 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 95.27 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 95.06 | |
| d2cyya1 | 60 | Putative transcriptional regulator PH1519 {Archaeo | 93.21 | |
| d2cg4a1 | 63 | Regulatory protein AsnC {Escherichia coli [TaxId: | 93.13 | |
| d2cfxa1 | 63 | Transcriptional regulator LrpC {Bacillus subtilis | 93.04 | |
| d1i1ga1 | 60 | LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 91.22 | |
| d1ig6a_ | 107 | MRF-2 DNA-binding domain {Human (Homo sapiens) [Ta | 89.38 | |
| d1kkxa_ | 102 | Transcription regulator Adr6 (Swi1) {Baker's yeast | 88.88 | |
| d1ryua_ | 120 | SWI-SNF complex protein p270, SMARCF1 {Human (Homo | 88.39 | |
| d1nexa1 | 70 | Centromere DNA-binding protein complex Cbf3 subuni | 87.54 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 86.19 | |
| d1c20a_ | 128 | DNA-binding domain from the dead ringer protein {F | 85.91 |
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: c-Myb, DNA-binding domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.92 E-value=4.1e-26 Score=122.05 Aligned_cols=52 Identities=42% Similarity=0.862 Sum_probs=49.6
Q ss_pred CCcCCCCHHHHHHHHHHHHHhCCCCchhhhhhhCCCCchhhHHHHHHhhhCCC
Q 041165 12 LKRGPWTIEEDHKLMSFILNNGIHCWRMVPKLAGLLRCGKSCRLRWINYLRPD 64 (85)
Q Consensus 12 ~~kg~WT~eED~~L~~~v~~~g~~~W~~Ia~~~~~~Rt~~qcr~Rw~~~l~~~ 64 (85)
|+||+||+|||++|+++|.+||.++|..||+.|+ +||+.||++||.++|+|+
T Consensus 1 l~rg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qc~~Rw~~~L~P~ 52 (52)
T d1gvda_ 1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52 (52)
T ss_dssp CCCCSCCHHHHHHHHHHHHHHCTTCHHHHHTTST-TCCHHHHHHHHHHTTSCC
T ss_pred CCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHC-CCCHHHHHHHHHhhCCCC
Confidence 5799999999999999999999889999999999 599999999999999984
|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ig6a_ a.4.3.1 (A:) MRF-2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkxa_ a.4.3.1 (A:) Transcription regulator Adr6 (Swi1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ryua_ a.4.3.1 (A:) SWI-SNF complex protein p270, SMARCF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1c20a_ a.4.3.1 (A:) DNA-binding domain from the dead ringer protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|