Citrus Sinensis ID: 041177

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------

MTKKAVLIGINYPGTKAELKGCVNDVKRMYACLVDRYGFSEENITVLIDTDDRSTQPTGRNIRRALGNLVRSAEPGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFREFVDQIPPGCEITVVSDSCHSGGLIDEAKEQIGESTRRDEEEESGSGFNFKSFLHKKVENAFESRGIHIPSGLRHHRPSGDEDVEDREVEAGYGEGGYHKNKSLPLSTLIEILKQQTGKDDIDVGKIRPTLFDMFGEDATPKVKKFMKVLLNKLKQGDGESGGGGFLGMVGSLAQEFLKHKLEESDESYAKPALETEVGSKKDVYAGGSKRSLPDGGILVSGCQTDQTSADASPSGKASEAYGALSNAIQIIIAESDGAVTNRELVLSTRQMLKKQGFTQQPGLYCHDNHVDKPFIC

cccEEEEEEEccccccccccccHHHHHHHHHHHHHHcccccccEEEEcccccccccccHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccccccccccccccccccccHHHHHHHHccccccEEEEEEccccccccccHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHcccccccccccHHHHcccccccccccccccccccccEEccccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccccccc

MTKKAVLIGINYPGTKAELKGCVNDVKRMYACLVDRYGFSEENITVLIDTDDRSTQPTGRNIRRALGNLVRSAEPGDVLFVHYSGHGTRLPAETGEDDDTGYDECIVPSDMNLITDDDFREFVDQIPPGCEITVVSDSCHSGGLID**************************FL***********************PS****VEDREVEAGYGEGGYHKNKSLPLSTLIEILKQQTGKDDIDVGKIRPTLFDMFGEDATPKVKKFMKVLLNKLK*******GGGFLGMVGSLAQEFL*************************************GGILVSGCQTDQTSADAS***KASEAYGALSNAIQIIIAESDGAVTNRELVLSTRQMLKKQGFTQQPGLYCHDNHVDKPFIC

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Metacaspase-4	Cysteine protease that cleaves specifically after arginine or lysine residues. Does not cleave caspase-specific substrates. Plays a positive regulatory role in biotic and abiotic stress-induced programmed cell death.	probable	O64517

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F6O, chain A
Confidence level:very confident
Coverage over the Query: 1-86,99-159,219-224,331-344,361-417
View the alignment between query and template
View the model in PyMOL

Template: 3BIJ, chain A
Confidence level:very confident
Coverage over the Query: 1-151,219-237,265-274,303,326-416
View the alignment between query and template
View the model in PyMOL