Citrus Sinensis ID: 041181

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380------

MALKLFFLKTSPILIALLFFAYPSCSAADVDPTTPVPPETICMYTPNPSDCKSVLPAASPNQTADTYTYCRLSIRKALTQTQKFLNSVDNYLKSGSTLSIGAIRALEDCRLLADLNMDYLSTSYQTANATSQILPAIQADDVQALLSAILTNQQTCFDGLQASANSSESINNGLSVPLLEDIKLSSVLLALFKKGWIGDQKKIITSWQPSSTQRLVGQNGRLPLVMSDRIRSIYESAVRGRKLTSTGDGDQGVLVTDIITVAQDGSGNFSTITDAINFAPNNTNVSNGYFLIYITAGVYQEYVSIPKNKINLLMIGDGINQTIITGNRSVADGWTTFNSATFSVVAPNFVASSITFRNTAGPSKGQAAALRSGADFSTFYSCSFEG

ccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccHHHHcccccccHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccEEEEccccccccccHHHHHHHccccccccccEEEEEEEcEEEEEEEEEccccccEEEEECcccccEEEEccccccccccccEEEEEECcccCEEEccEEEEccccccccEEEEEEcccCEEEEccCECc

**LKLFFLKTSPILIALLFFAYPSCS****DPTTPVPPETICMYTPNPSDCK**********TADTYTYCRLSIRKALTQTQKFLNSVDNYLKSGSTLSIGAIRALEDCRLLADLNMDYLSTSYQTANATSQILPAIQADDVQALLSAILTNQQTCFDGLQASANS*ESINNGLSVPLLEDIKLSSVLLALFKKGWIGD**********************LPLVMSDRIRSIYESAVRGRKLTSTGDGDQGVLVTDIITVAQDGSGNFSTITDAINFAPNNTNVSNGYFLIYITAGVYQEYVSIPKNKINLLMIGDGINQTIITGNRSVADGWTTFNSATFSVVAPNFVASSITFRNTAGPSKGQAAALRSGADFSTFYSCSFEG

xxxxxxxxxxHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable pectinesterase/pectinesterase inhibitor 41	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	probable	Q8RXK7

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GQ8, chain A
Confidence level:very confident
Coverage over the Query: 255-386
View the alignment between query and template
View the model in PyMOL

Template: 1XG2, chain B
Confidence level:confident
Coverage over the Query: 36-195
View the alignment between query and template
View the model in PyMOL