Citrus Sinensis ID: 041209


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410--
MRIINEPTAAAIAYGLDNKASRTVKATAGDTHLGGEDFDNRLVNHFVAEFKRKHKKDISGNARALRRLQTTTIEIDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDSKIDKSQVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNKKVQDLLLLDVTPLSLGIETAGDNRPSVLIQVYEGERARTKDNNLLGKFELKGIPPAPRGVPQINVCFDIDANGILHVSAKDKTAGITITNDKGRLSKEEIERMVQEAEKYKAEDEEIKKKVEAKNSLENYAYNMSNTVRDEKFAGKLDPADKQKIEKAIDEAIEWLDGNQLVEVDELEDKLKELKGFCNPIIAKMYEGGASGDVPMGGGAEMPGGGHGKAETGGASGGPKIEEVD
cccccHHHHHHHHHHccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHcccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccEEEECcccccccEEccccccccEEEEEEcccccccccccccccEEcccccccccccccEEEEEEEcccccEEEEEEEccccEEEEcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccc
MRIINEPTAAAIAYGLDNKASRTVKATAGDTHLGGEDFDNRLVNHFVAEFKRKHKKDISGNARALRRLQTTTIEIDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDSKIDKSQVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNKKVQDLLLLDVTPLSLGIETAGDNRPSVLIQVYEGERARTKDNNLLGKFELKGIPPAPRGVPQINVCFDIDANGILHVSAKDKTAGITITNDKGRLSKEEIERMVQEAEKYKAEDE******EAKNSLENYAYNMSNT****************KIEKAIDEAIEWLDGNQLVEVDELEDKLKELKGFCNPIIAKMYE**************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIINEPTAAAIAYGLDNKASRTVKATAGDTHLGGEDFDNRLVNHFVAEFKRKHKKDISGNARALRRLQTTTIEIDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDSKIDKSQVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNKKVQDLLLLDVTPLSLGIETAGDNRPSVLIQVYEGERARTKDNNLLGKFELKGIPPAPRGVPQINVCFDIDANGILHVSAKDKTAGITITNDKGRLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxNSLENYAYNMSNTVRDEKFAGKLDPADKQKIEKAIDEAIEWLDGNQLVEVDELEDKLKELKGFCNPIIAKMYEGGASGDVPMGGGAEMPGGGHGKAETGGASGGPKIEEVD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heat shock 70 kDa protein probableP26413
Heat shock 70 kDa protein 5 In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.probableQ9S9N1
Heat shock cognate 70 kDa protein probableP09189

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YUW, chain A
Confidence level:very confident
Coverage over the Query: 1-316
View the alignment between query and template
View the model in PyMOL
Template: 2KHO, chain A
Confidence level:very confident
Coverage over the Query: 1-373
View the alignment between query and template
View the model in PyMOL
Template: 1UD0, chain A
Confidence level:very confident
Coverage over the Query: 299-374
View the alignment between query and template
View the model in PyMOL