Citrus Sinensis ID: 041243

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400------
MDKKNENGEESVNKDGSICGYDSLHTLLSANLKPHIYQEVSRLLHGLNCGKPLELVALSANGKALSSEHDFDLQGFCFRADKEFLREPRVVRVGLIQNSIVLPTTLHFLDQKKAIFQKLKLLIDAAGVSGVNILCLQEAWTMPFAFCTREKRWCEFAEPVDGESTQFLQELARKYNMVIISPILERDVNHGDTIWNTAIIIGNHGNIIGKHRKNHIPRVGDFNESTYYMEGNTGHPVFETAFGKIAVNICYGRHHPLNWLAFGLNGAEIVFNPSATVGELSEPMWPIEARNAAIANSYFVGSINRVGTEVFPNPFTSGDGKPQHKDFGHFYGSSHFSAPDGSCTPSLSRFRDGLLISDMDLNLCRQLKDKWGFRMTARYELYAEMLANYSKADYEPQVISDPLLHK
cccccccccccccccccccccccHHHHHHHcccHHHHHHHHHHHcccccccccccccccHHHHHHccccccccccccccccccccccccEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEcccccccccccccccccccccccccccHHHHHHHHHHHHccEEEEccccEECcccccEEEEEEEEEcccccEEccccccccccccccccccEECccccccccccccccEEEEEEEcccccHHHHHHHHHccccEEECccccccccccccHHHHHHHHHHHcccEEEEEcccccccccccccccccccccccccEEEEEEEEEcccccEEccccccccEEEEEEcccHHHHHHHHHccccccccHHHHHHHHHccccccccccccccccccc
****************SICGYDSLHTLLSANLKPHIYQEVSRLLHGLNCGKPLELVALSANGKALSSEHDFDLQGFCFRADKEFLREPRVVRVGLIQNSIVLPTTLHFLDQKKAIFQKLKLLIDAAGVSGVNILCLQEAWTMPFAFCTREKRWCEFAEPVDGESTQFLQELARKYNMVIISPILERDVNHGDTIWNTAIIIGNHGNIIGKHRKNHIPRVGDFNESTYYMEGNTGHPVFETAFGKIAVNICYGRHHPLNWLAFGLNGAEIVFNPSATVGELSEPMWPIEARNAAIANSYFVGSINRVGTEVFPNPFTSGDGKPQHKDFGHFYGSSHFSAPDGSCTPSLSRFRDGLLISDMDLNLCRQLKDKWGFRMTARYELYAEMLANYSKADYEPQVI*D*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKKNENGEESVNKDGSICGYDSLHTLLSANLKPHIYQEVSRLLHGLNCGKPLELVALSANGKALSSEHDFDLQGFCFRADKEFLREPRVVRVGLIQNSIVLPTTLHFLDQKKAIFQKLKLLIDAAGVSGVNILCLQEAWTMPFAFCTREKRWCEFAEPVDGESTQFLQELARKYNMVIISPILERDVNHGDTIWNTAIIIGNHGNIIGKHRKNHIPRVGDFNESTYYMEGNTGHPVFETAFGKIAVNICYGRHHPLNWLAFGLNGAEIVFNPSATVGELSEPMWPIEARNAAIANSYFVGSINRVGTEVFPNPFTSGDGKPQHKDFGHFYGSSHFSAPDGSCTPSLSRFRDGLLISDMDLNLCRQLKDKWGFRMTARYELYAEMLANYSKADYEPQVISDPLLHK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beta-ureidopropionase Converts N-carbamyl-beta-aminoisobutyric acid and N-carbamyl-beta-alanine to, respectively, beta-aminoisobutyric acid and beta-alanine, ammonia and carbon dioxide.probableQ8VC97
Beta-ureidopropionase Converts N-carbamyl-beta-aminoisobutyric acid and N-carbamyl-beta-alanine to, respectively, beta-aminoisobutyric acid and beta-alanine, ammonia and carbon dioxide.probableQ5RBM6
Beta-ureidopropionase Converts N-carbamyl-beta-aminoisobutyric acid and N-carbamyl-beta-alanine to, respectively, beta-aminoisobutyric acid and beta-alanine, ammonia and carbon dioxide.probableQ964D8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.5.-.-Acting on carbon-nitrogen bonds, other than peptide bonds.probable
3.5.1.-11-cis-retinol dehydrogenase.probable
3.5.1.6Beta-ureidopropionase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VHH, chain A
Confidence level:very confident
Coverage over the Query: 21-218,229-311,329-402
View the alignment between query and template
View the model in PyMOL