Citrus Sinensis ID: 041276


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MAQAYDHDRQDRWSLQGMTALVTGGTKGLGNEAELNECLREWKTKCFKVTGSVCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTNFESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLAKNLACEWARDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPGEPKEVSSLVAFLCMPAASYITGQTICVDGGFTVNGFFFRRT
ccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccEEEEcccccccccccccc
ccccccccccccccccccEEEEEccccHHHcHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccccccEEEEcccEEEccccHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccEEEEEEccHHHcccccccHHHHHHHHHHHHHHHHHHHHcHHHcEEEEEEEEccEccHHHHHHcccHHHHHHHHHHccccccEcHHHHHHHHHHHHcHHHccccccEEEEcccHHHcccccccc
maqaydhdrqdrwslQGMTALVTggtkglgneAELNECLREWKTKCFkvtgsvcdasSRAEREKLMKQVSSLFNGKLNILINnvgtnyttkptVEYMAEDLSFLMSTNFESAYHLSQLAHPllkasgagniILVSSVCGVLSTNLGTIYAATKGAMNQLAKNLACewardnirinsvapwfittpltepylsdekfleevkcrtpmerpgepkeVSSLVAFLCmpaasyitgqticvdggftvngfffrrt
maqaydhdrqdrwslqGMTALVTggtkglgnEAELNECLREWKTKCFKVTGSVCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTNFESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLAKNLACEWARDNIRINsvapwfittpltepylsdekFLEEVKCRTpmerpgepkevSSLVAFLCMPAASYITGQTICVDGGFTVNGFFFRRT
MAQAYDHDRQDRWSLQGMTALVTGGTKGLGNEAELNECLREWKTKCFKVTGSVCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTNFESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLAKNLACEWARDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPGEPKEVSSLVAFLCMPAASYITGQTICVDGGFTVNGFFFRRT
************WSLQGMTALVTGGTKGLGNEAELNECLREWKTKCFKVTGSVCDA********LMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTNFESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLAKNLACEWARDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKC*************SSLVAFLCMPAASYITGQTICVDGGFTVNGFFF***
**************LQGMTALVTGGTKGLGNEAELNECLREWKTKCFKVTGSVCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTNFESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLAKNLACEWARDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPGEPKEVSSLVAFLCMPAASYITGQTICVDGGFTVNGFFFR**
***********RWSLQGMTALVTGGTKGLGNEAELNECLREWKTKCFKVTGSVCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTNFESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLAKNLACEWARDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKCRT**********VSSLVAFLCMPAASYITGQTICVDGGFTVNGFFFRRT
*************SLQGMTALVTGGTKGLGNEAELNECLREWKTKCFKVTGSVCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTNFESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLAKNLACEWARDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPGEPKEVSSLVAFLCMPAASYITGQTICVDGGFTVNGFFFR**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQAYDHDRQDRWSLQGMTALVTGGTKGLGNEAELNECLREWKTKCFKVTGSVCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTNFESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLAKNLACEWARDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPGEPKEVSSLVAFLCMPAASYITGQTICVDGGFTVNGFFFRRT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query251 2.2.26 [Sep-21-2011]
Q9ASX2266 Tropinone reductase homol no no 0.956 0.902 0.636 8e-90
P50165268 Tropinone reductase homol N/A no 0.944 0.884 0.553 4e-78
P50162273 Tropinone reductase 1 OS= N/A no 0.944 0.868 0.513 2e-71
P50164260 Tropinone reductase 2 OS= N/A no 0.936 0.903 0.503 5e-68
P50163260 Tropinone reductase 2 OS= N/A no 0.932 0.9 0.507 2e-67
P50199256 Gluconate 5-dehydrogenase yes no 0.916 0.898 0.305 4e-27
Q9X248246 3-oxoacyl-[acyl-carrier-p no no 0.896 0.914 0.302 1e-26
P51831246 3-oxoacyl-[acyl-carrier-p yes no 0.888 0.906 0.322 2e-25
P50842254 2-dehydro-3-deoxy-D-gluco no no 0.920 0.909 0.294 8e-24
P94681252 4-formylbenzenesulfonate yes no 0.912 0.908 0.305 2e-23
>sp|Q9ASX2|TRNH1_ARATH Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1 Back     alignment and function desciption
 Score =  330 bits (845), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 166/261 (63%), Positives = 196/261 (75%), Gaps = 21/261 (8%)

Query: 8   DRQDRWSLQGMTALVTGGTKGLG-------------------NEAELNECLREWKTKCFK 48
           ++  RWSL+  T LVTGGTKG+G                   NE ELNECL +W+ K F+
Sbjct: 5   EQSQRWSLKAKTVLVTGGTKGIGHAIVEEFAGFGAVIHTCARNEYELNECLSKWQKKGFQ 64

Query: 49  VTGSVCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTN 108
           VTGSVCDAS R EREKLM+ VSS+F GKL+ILINN+G    +KPT++Y AED SF +STN
Sbjct: 65  VTGSVCDASLRPEREKLMQTVSSMFGGKLDILINNLGA-IRSKPTLDYTAEDFSFHISTN 123

Query: 109 FESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLAKNLACEWA 168
            ESAYHLSQLAHPLLKASG GNII +SS+ GV+S ++G+IY+ATKGA+NQLA+NLACEWA
Sbjct: 124 LESAYHLSQLAHPLLKASGCGNIIFMSSIAGVVSASVGSIYSATKGALNQLARNLACEWA 183

Query: 169 RDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPGEPKEVSSLVAFLCMPAAS 228
            D IR N+VAP  I TPL E    DE F + V  R P+ R GEP+EVSSLVAFLCMPAAS
Sbjct: 184 SDGIRANAVAPAVIATPLAEAVYDDE-FKKVVISRKPLGRFGEPEEVSSLVAFLCMPAAS 242

Query: 229 YITGQTICVDGGFTVNGFFFR 249
           YITGQTICVDGG TVNGF ++
Sbjct: 243 YITGQTICVDGGLTVNGFSYQ 263





Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|P50165|TRNH_DATST Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1 Back     alignment and function description
>sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 Back     alignment and function description
>sp|P50164|TRN2_HYONI Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1 Back     alignment and function description
>sp|P50163|TRN2_DATST Tropinone reductase 2 OS=Datura stramonium GN=TR2 PE=1 SV=1 Back     alignment and function description
>sp|P50199|GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=gno PE=1 SV=1 Back     alignment and function description
>sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 Back     alignment and function description
>sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 Back     alignment and function description
>sp|P50842|KDUD_BACSU 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Bacillus subtilis (strain 168) GN=kduD PE=2 SV=1 Back     alignment and function description
>sp|P94681|TSAC_COMTE 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 OS=Comamonas testosteroni GN=tsaC1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
158828210269 TRL10 [Cleome spinosa] 0.984 0.918 0.686 1e-99
255558968268 tropinone reductase, putative [Ricinus c 0.976 0.914 0.684 4e-98
158828209280 TRL11 [Cleome spinosa] 0.984 0.882 0.652 2e-95
3980415268 putative tropinone reductase [Arabidopsi 0.976 0.914 0.650 4e-93
225449410268 PREDICTED: tropinone reductase homolog A 0.976 0.914 0.645 9e-93
158578532293 tropinone-reductase-like protein [Boeche 0.952 0.815 0.644 3e-91
225449408268 PREDICTED: tropinone reductase homolog A 0.980 0.917 0.624 3e-91
359478910270 PREDICTED: tropinone reductase homolog A 0.976 0.907 0.620 9e-91
147769646270 hypothetical protein VITISV_035429 [Viti 0.976 0.907 0.635 1e-90
158828187271 tropinone-reductase-like53 [Arabidopsis 0.984 0.911 0.634 2e-90
>gi|158828210|gb|ABW81088.1| TRL10 [Cleome spinosa] Back     alignment and taxonomy information
 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 184/268 (68%), Positives = 207/268 (77%), Gaps = 21/268 (7%)

Query: 1   MAQAYDHDRQD-RWSLQGMTALVTGGTKGLGNEA-------------------ELNECLR 40
           MA+A +  RQ+ RWSLQG TALVTGGTKGLG                       LN+CLR
Sbjct: 1   MAKAEESIRQNSRWSLQGKTALVTGGTKGLGEAVVEELAGFGARIHTCARDGDHLNKCLR 60

Query: 41  EWKTKCFKVTGSVCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAED 100
           EW+ K F+VTGSVCD S R EREKLM+ VSSLFNG+LNILINNVGTN T KPT EY AED
Sbjct: 61  EWQAKGFQVTGSVCDVSLRTEREKLMETVSSLFNGELNILINNVGTNMT-KPTTEYTAED 119

Query: 101 LSFLMSTNFESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLA 160
            SFLM+TNFES+YHL QL+HPLLKASG+G+I+ +SSVCGV+S N+G+IY ATKGAMNQL 
Sbjct: 120 FSFLMATNFESSYHLCQLSHPLLKASGSGSIVFMSSVCGVVSINVGSIYGATKGAMNQLT 179

Query: 161 KNLACEWARDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPGEPKEVSSLVA 220
           +NLACEWA DNIR NSV PWFI+TPL   YL DEKF E V  R P+ R GEP+EVSSLV 
Sbjct: 180 RNLACEWASDNIRANSVCPWFISTPLAYRYLEDEKFKEAVVSRNPIRRVGEPEEVSSLVT 239

Query: 221 FLCMPAASYITGQTICVDGGFTVNGFFF 248
           FLC+PAASYITGQTICVDGG TVNGF F
Sbjct: 240 FLCLPAASYITGQTICVDGGMTVNGFSF 267




Source: Cleome spinosa

Species: Cleome spinosa

Genus: Cleome

Family: Cleomaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255558968|ref|XP_002520507.1| tropinone reductase, putative [Ricinus communis] gi|223540349|gb|EEF41920.1| tropinone reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|158828209|gb|ABW81087.1| TRL11 [Cleome spinosa] Back     alignment and taxonomy information
>gi|3980415|gb|AAC95218.1| putative tropinone reductase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225449410|ref|XP_002277835.1| PREDICTED: tropinone reductase homolog At1g07440 [Vitis vinifera] gi|296086189|emb|CBI31630.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|158578532|gb|ABW74557.1| tropinone-reductase-like protein [Boechera divaricarpa] Back     alignment and taxonomy information
>gi|225449408|ref|XP_002282755.1| PREDICTED: tropinone reductase homolog At1g07440 [Vitis vinifera] gi|296086188|emb|CBI31629.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359478910|ref|XP_003632186.1| PREDICTED: tropinone reductase homolog At1g07440-like [Vitis vinifera] gi|297746015|emb|CBI16071.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147769646|emb|CAN63543.1| hypothetical protein VITISV_035429 [Vitis vinifera] Back     alignment and taxonomy information
>gi|158828187|gb|ABW81066.1| tropinone-reductase-like53 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
TAIR|locus:2043177269 SAG13 "senescence-associated g 0.864 0.806 0.680 5.7e-84
TAIR|locus:2043167271 AT2G29360 [Arabidopsis thalian 0.868 0.804 0.675 1.2e-83
TAIR|locus:2043037268 AT2G29150 [Arabidopsis thalian 0.864 0.809 0.666 1.9e-83
TAIR|locus:2043052262 AT2G29290 [Arabidopsis thalian 0.868 0.832 0.657 8.3e-83
TAIR|locus:2025072266 AT1G07440 [Arabidopsis thalian 0.864 0.815 0.694 1.1e-82
TAIR|locus:2042992260 TRI "tropinone reductase" [Ara 0.852 0.823 0.665 4e-81
TAIR|locus:2043152268 AT2G29370 [Arabidopsis thalian 0.856 0.802 0.662 1.1e-80
TAIR|locus:2025057260 AT1G07450 [Arabidopsis thalian 0.864 0.834 0.652 2.2e-80
TAIR|locus:2152815264 AT5G06060 [Arabidopsis thalian 0.864 0.821 0.646 2.8e-80
TAIR|locus:2054447262 AT2G30670 [Arabidopsis thalian 0.868 0.832 0.639 3.2e-79
TAIR|locus:2043177 SAG13 "senescence-associated gene 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 768 (275.4 bits), Expect = 5.7e-84, Sum P(2) = 5.7e-84
 Identities = 149/219 (68%), Positives = 177/219 (80%)

Query:    31 NEAELNECLREWKTKCFKVTGSVCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTT 90
             +E +L E LREW+ K F+VT SVCD SSR +R KLM+ VSSL+ GKLNIL+NNVGT+   
Sbjct:    50 DETQLQERLREWQAKGFQVTTSVCDVSSRDQRVKLMETVSSLYQGKLNILVNNVGTSIF- 108

Query:    91 KPTVEYMAEDLSFLMSTNFESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYA 150
             KPT EY AED SF+M+TN ESA+HLSQLAHPLLKASG+G+I+L+SS  GV+  N+G+IY 
Sbjct:   109 KPTTEYTAEDFSFVMATNLESAFHLSQLAHPLLKASGSGSIVLISSAAGVVHVNVGSIYG 168

Query:   151 ATKGAMNQLAKNLACEWARDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPG 210
             ATKGAMNQLA+NLACEWA DNIR NSV PW+ITTPL+  +  DE+F +E    TPM R G
Sbjct:   169 ATKGAMNQLARNLACEWASDNIRTNSVCPWYITTPLSNDFF-DEEFKKEAVRTTPMGRVG 227

Query:   211 EPKEVSSLVAFLCMPAASYITGQTICVDGGFTVNGFFFR 249
             E  EVS LVAFLC+P+ASYITGQTICVDGG TVNGF F+
Sbjct:   228 EANEVSPLVAFLCLPSASYITGQTICVDGGATVNGFSFK 266


GO:0000166 "nucleotide binding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
GO:0007568 "aging" evidence=IEP;RCA
GO:0004022 "alcohol dehydrogenase (NAD) activity" evidence=TAS
GO:0002213 "defense response to insect" evidence=IEP
TAIR|locus:2043167 AT2G29360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043037 AT2G29150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043052 AT2G29290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025072 AT1G07440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042992 TRI "tropinone reductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043152 AT2G29370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025057 AT1G07450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152815 AT5G06060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054447 AT2G30670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P94681TSAC_COMTE1, ., 2, ., 1, ., 6, 20.30550.91230.9087yesno
P0A0H9FABG_STAAM1, ., 1, ., 1, ., 1, 0, 00.32790.85650.8739yesno
Q5HGK2FABG_STAAC1, ., 1, ., 1, ., 1, 0, 00.32790.85650.8739yesno
P99093FABG_STAAN1, ., 1, ., 1, ., 1, 0, 00.32790.85650.8739yesno
Q9KQH7FABG_VIBCH1, ., 1, ., 1, ., 1, 0, 00.31570.88840.9139yesno
P50162TRN1_DATST1, ., 1, ., 1, ., 2, 0, 60.51320.94420.8681N/Ano
P50163TRN2_DATST1, ., 1, ., 1, ., 2, 3, 60.50770.93220.9N/Ano
P50164TRN2_HYONI1, ., 1, ., 1, ., 2, 3, 60.50380.93620.9038N/Ano
P50165TRNH_DATST1, ., 1, ., 1, ., -0.55340.94420.8843N/Ano
P50199GNO_GLUOX1, ., 1, ., 1, ., 6, 90.30580.91630.8984yesno
P51831FABG_BACSU1, ., 1, ., 1, ., 1, 0, 00.32270.88840.9065yesno
P43713FABG_HAEIN1, ., 1, ., 1, ., 1, 0, 00.33190.88440.9173yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00018426001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (268 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
cd05329251 cd05329, TR_SDR_c, tropinone reductase-I and II (T 1e-129
PRK09242257 PRK09242, PRK09242, tropinone reductase; Provision 5e-94
cd05233234 cd05233, SDR_c, classical (c) SDRs 2e-58
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-56
COG1028251 COG1028, FabG, Dehydrogenases with different speci 1e-54
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 1e-50
PRK07231251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-50
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 4e-50
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-49
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-49
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 9e-49
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 2e-45
cd05352252 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (M 4e-45
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 1e-44
PRK12829264 PRK12829, PRK12829, short chain dehydrogenase; Pro 1e-44
PRK06124256 PRK06124, PRK06124, gluconate 5-dehydrogenase; Pro 2e-42
PRK08213259 PRK08213, PRK08213, gluconate 5-dehydrogenase; Pro 8e-41
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrog 5e-40
cd05344253 cd05344, BKR_like_SDR_like, putative beta-ketoacyl 2e-39
PRK06701290 PRK06701, PRK06701, short chain dehydrogenase; Pro 6e-39
PRK12827249 PRK12827, PRK12827, short chain dehydrogenase; Pro 2e-38
cd05358253 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (Glc 4e-38
cd05359242 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_c 5e-38
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Val 4e-37
PRK07097265 PRK07097, PRK07097, gluconate 5-dehydrogenase; Pro 1e-36
cd05364253 cd05364, SDR_c11, classical (c) SDR, subgroup 11 1e-36
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Pro 1e-36
PRK06172253 PRK06172, PRK06172, short chain dehydrogenase; Pro 1e-35
PRK12429258 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenas 2e-35
cd05362243 cd05362, THN_reductase-like_SDR_c, tetrahydroxynap 6e-35
PRK06463255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) 7e-35
cd05369249 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reducta 9e-35
PRK12824245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Pro 2e-34
cd05341247 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta 3e-34
cd05365242 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroi 4e-34
TIGR01963255 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase 6e-34
PRK06484520 PRK06484, PRK06484, short chain dehydrogenase; Val 1e-33
PRK07523255 PRK07523, PRK07523, gluconate 5-dehydrogenase; Pro 3e-33
cd05355270 cd05355, SDR_c1, classical (c) SDR, subgroup 1 6e-33
cd08942250 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacy 6e-33
PRK07814263 PRK07814, PRK07814, short chain dehydrogenase; Pro 2e-32
PRK12743256 PRK12743, PRK12743, oxidoreductase; Provisional 2e-32
PRK08226263 PRK08226, PRK08226, short chain dehydrogenase; Pro 3e-32
PRK07035252 PRK07035, PRK07035, short chain dehydrogenase; Pro 3e-32
cd08936256 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl re 5e-32
PRK06113255 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydro 5e-32
cd05345248 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl 7e-32
PRK08936261 PRK08936, PRK08936, glucose-1-dehydrogenase; Provi 2e-31
PRK08589272 PRK08589, PRK08589, short chain dehydrogenase; Val 7e-31
cd08944246 cd08944, SDR_c12, classical (c) SDR, subgroup 12 1e-30
PRK06138252 PRK06138, PRK06138, short chain dehydrogenase; Pro 5e-30
TIGR01832248 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogena 2e-29
TIGR02415254 TIGR02415, 23BDH, acetoin reductases 3e-29
cd08940258 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydroge 3e-29
cd05366257 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol 4e-29
PRK06500249 PRK06500, PRK06500, short chain dehydrogenase; Pro 7e-29
cd05330257 cd05330, cyclohexanol_reductase_SDR_c, cyclohexano 1e-28
PRK06171266 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydro 3e-28
cd08930250 cd08930, SDR_c8, classical (c) SDR, subgroup 8 3e-28
PRK08265261 PRK08265, PRK08265, short chain dehydrogenase; Pro 1e-27
PRK07856252 PRK07856, PRK07856, short chain dehydrogenase; Pro 1e-27
cd08937256 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa 1e-27
cd08935271 cd08935, mannonate_red_SDR_c, putative D-mannonate 2e-27
cd05326249 cd05326, secoisolariciresinol-DH_like_SDR_c, secoi 3e-27
cd05357234 cd05357, PR_SDR_c, pteridine reductase (PR), class 7e-27
PRK08085254 PRK08085, PRK08085, gluconate 5-dehydrogenase; Pro 9e-27
PRK06398258 PRK06398, PRK06398, aldose dehydrogenase; Validate 1e-26
cd05328250 cd05328, 3alpha_HSD_SDR_c, alpha hydroxysteroid de 2e-26
TIGR01829242 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reducta 3e-26
PRK08063250 PRK08063, PRK08063, enoyl-(acyl carrier protein) r 3e-26
PRK06523260 PRK06523, PRK06523, short chain dehydrogenase; Pro 3e-26
cd05351244 cd05351, XR_like_SDR_c, xylulose reductase-like, c 5e-26
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Pro 6e-26
cd05361242 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol de 7e-26
TIGR03971265 TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil 7e-26
PRK06550235 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-25
PRK06077252 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-25
PRK12936245 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-prote 2e-25
PRK08993253 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrog 2e-25
PRK07060245 PRK07060, PRK07060, short chain dehydrogenase; Pro 3e-25
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Pro 6e-25
PRK06200263 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydropheny 6e-25
PRK07774250 PRK07774, PRK07774, short chain dehydrogenase; Pro 7e-25
PRK09135249 PRK09135, PRK09135, pteridine reductase; Provision 1e-24
PRK12935247 PRK12935, PRK12935, acetoacetyl-CoA reductase; Pro 2e-24
PRK07577234 PRK07577, PRK07577, short chain dehydrogenase; Pro 2e-24
cd05368241 cd05368, DHRS6_like_SDR_c, human DHRS6-like, class 3e-24
PRK08324681 PRK08324, PRK08324, short chain dehydrogenase; Val 3e-24
PRK07063260 PRK07063, PRK07063, short chain dehydrogenase; Pro 4e-24
PRK13394262 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenas 4e-24
PRK08628258 PRK08628, PRK08628, short chain dehydrogenase; Pro 4e-24
PRK07478254 PRK07478, PRK07478, short chain dehydrogenase; Pro 7e-24
cd05332257 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxyste 1e-23
PRK05867253 PRK05867, PRK05867, short chain dehydrogenase; Pro 1e-23
cd05337255 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl 2e-23
PRK08277278 PRK08277, PRK08277, D-mannonate oxidoreductase; Pr 2e-23
cd08945258 cd08945, PKR_SDR_c, Polyketide ketoreductase, clas 3e-23
PRK07069251 PRK07069, PRK07069, short chain dehydrogenase; Val 4e-23
PRK06114254 PRK06114, PRK06114, short chain dehydrogenase; Pro 2e-22
PRK12481251 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrog 6e-22
TIGR01831239 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-prote 1e-21
PRK07576264 PRK07576, PRK07576, short chain dehydrogenase; Pro 1e-21
PRK06128300 PRK06128, PRK06128, oxidoreductase; Provisional 2e-21
cd09761242 cd09761, A3DFK9-like_SDR_c, Clostridium thermocell 2e-21
PRK12745256 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-prote 4e-21
PRK06057255 PRK06057, PRK06057, short chain dehydrogenase; Pro 6e-21
TIGR04316250 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxyben 6e-21
cd08943250 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate al 6e-21
TIGR03206250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxy 9e-21
cd08932223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 1e-20
cd05331244 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydroz 2e-20
cd05374248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 3e-20
cd08933261 cd08933, RDH_SDR_c, retinal dehydrogenase-like, cl 4e-20
PRK06949258 PRK06949, PRK06949, short chain dehydrogenase; Pro 5e-20
cd05349246 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl 5e-20
pfam13561239 pfam13561, adh_short_C2, Enoyl-(Acyl carrier prote 7e-20
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Pro 7e-20
PRK07074257 PRK07074, PRK07074, short chain dehydrogenase; Pro 1e-19
PRK09730247 PRK09730, PRK09730, putative NAD(P)-binding oxidor 1e-19
PRK12823260 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1 2e-19
PRK08220252 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehy 4e-19
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 4e-19
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 5e-19
PRK12746254 PRK12746, PRK12746, short chain dehydrogenase; Pro 6e-19
COG0300265 COG0300, DltE, Short-chain dehydrogenases of vario 6e-19
PRK08643256 PRK08643, PRK08643, acetoin reductase; Validated 8e-19
cd05370228 cd05370, SDR_c2, classical (c) SDR, subgroup 2 9e-19
cd05363254 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), 9e-19
PRK07890258 PRK07890, PRK07890, short chain dehydrogenase; Pro 1e-18
PRK08217253 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-18
PRK07067257 PRK07067, PRK07067, sorbitol dehydrogenase; Provis 2e-18
PRK05875276 PRK05875, PRK05875, short chain dehydrogenase; Pro 4e-18
cd09763265 cd09763, DHRS1-like_SDR_c, human dehydrogenase/red 5e-18
PRK06947248 PRK06947, PRK06947, glucose-1-dehydrogenase; Provi 8e-18
cd08939239 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine 9e-18
PRK06123248 PRK06123, PRK06123, short chain dehydrogenase; Pro 1e-17
cd05348257 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydro 2e-17
PRK07666239 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) 4e-17
cd05356239 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxyst 7e-17
PRK12742237 PRK12742, PRK12742, oxidoreductase; Provisional 1e-16
PRK06198260 PRK06198, PRK06198, short chain dehydrogenase; Pro 2e-16
PRK12748256 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-prote 2e-16
cd05338246 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogena 3e-16
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenas 5e-16
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 5e-16
cd05350239 cd05350, SDR_c6, classical (c) SDR, subgroup 6 8e-16
PRK07677252 PRK07677, PRK07677, short chain dehydrogenase; Pro 1e-15
cd05323244 cd05323, ADH_SDR_c_like, insect type alcohol dehyd 1e-15
PRK07831262 PRK07831, PRK07831, short chain dehydrogenase; Pro 1e-15
PRK12747252 PRK12747, PRK12747, short chain dehydrogenase; Pro 2e-15
cd05346249 cd05346, SDR_c5, classical (c) SDR, subgroup 5 2e-15
PRK12384259 PRK12384, PRK12384, sorbitol-6-phosphate dehydroge 4e-15
PRK12938246 PRK12938, PRK12938, acetyacetyl-CoA reductase; Pro 4e-15
PRK07985294 PRK07985, PRK07985, oxidoreductase; Provisional 5e-15
PRK07062265 PRK07062, PRK07062, short chain dehydrogenase; Pro 6e-15
PRK06181263 PRK06181, PRK06181, short chain dehydrogenase; Pro 6e-15
TIGR02632676 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate 6e-15
PRK09186256 PRK09186, PRK09186, flagellin modification protein 8e-15
COG3967245 COG3967, DltE, Short-chain dehydrogenase involved 1e-14
PRK12859256 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-prote 2e-14
PRK06125259 PRK06125, PRK06125, short chain dehydrogenase; Pro 2e-14
PLN02253280 PLN02253, PLN02253, xanthoxin dehydrogenase 2e-14
PRK08416260 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydro 4e-14
cd08929226 cd08929, SDR_c4, classical (c) SDR, subgroup 4 5e-14
cd05372250 cd05372, ENR_SDR, Enoyl acyl carrier protein (ACP) 7e-14
cd05339243 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy 7e-14
PRK08642253 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-13
TIGR03325262 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3- 2e-13
PRK07326237 PRK07326, PRK07326, short chain dehydrogenase; Pro 3e-13
PRK08261450 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-13
PRK06940275 PRK06940, PRK06940, short chain dehydrogenase; Pro 5e-13
cd08931227 cd08931, SDR_c9, classical (c) SDR, subgroup 9 6e-13
PRK12428241 PRK12428, PRK12428, 3-alpha-hydroxysteroid dehydro 8e-13
cd05327269 cd05327, retinol-DH_like_SDR_c_like, retinol dehyd 9e-13
cd05353250 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)- 9e-13
cd05354235 cd05354, SDR_c7, classical (c) SDR, subgroup 7 2e-12
TIGR02685267 TIGR02685, pter_reduc_Leis, pteridine reductase 6e-12
cd05371252 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydr 6e-12
cd05340236 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-li 7e-12
PRK05717255 PRK05717, PRK05717, oxidoreductase; Validated 8e-12
PRK07041230 PRK07041, PRK07041, short chain dehydrogenase; Pro 8e-12
PRK08267260 PRK08267, PRK08267, short chain dehydrogenase; Pro 8e-12
PRK08264238 PRK08264, PRK08264, short chain dehydrogenase; Val 9e-12
cd05322257 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehy 1e-11
PRK05786238 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-11
cd08934243 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase 2e-11
PRK07370258 PRK07370, PRK07370, enoyl-(acyl carrier protein) r 3e-11
COG0623259 COG0623, FabI, Enoyl-[acyl-carrier-protein] 3e-11
PRK08339263 PRK08339, PRK08339, short chain dehydrogenase; Pro 5e-11
cd05360233 cd05360, SDR_c3, classical (c) SDR, subgroup 3 6e-11
PRK08017256 PRK08017, PRK08017, oxidoreductase; Provisional 7e-11
PRK07792306 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-10
PRK08263275 PRK08263, PRK08263, short chain dehydrogenase; Pro 2e-10
PRK08340259 PRK08340, PRK08340, glucose-1-dehydrogenase; Provi 3e-10
PRK12744257 PRK12744, PRK12744, short chain dehydrogenase; Pro 3e-09
cd05367241 cd05367, SPR-like_SDR_c, sepiapterin reductase (SP 5e-09
PRK07533258 PRK07533, PRK07533, enoyl-(acyl carrier protein) r 6e-09
PRK06179270 PRK06179, PRK06179, short chain dehydrogenase; Pro 1e-08
PRK06483236 PRK06483, PRK06483, dihydromonapterin reductase; P 1e-08
cd05343250 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, c 1e-08
cd05334221 cd05334, DHPR_SDR_c_like, dihydropteridine reducta 4e-08
cd02266186 cd02266, SDR, Short-chain dehydrogenases/reductase 5e-08
PRK08594257 PRK08594, PRK08594, enoyl-(acyl carrier protein) r 7e-08
cd11731198 cd11731, Lin1944_like_SDR_c, Lin1944 and related p 2e-07
PRK09134258 PRK09134, PRK09134, short chain dehydrogenase; Pro 3e-07
PRK09072263 PRK09072, PRK09072, short chain dehydrogenase; Pro 3e-07
PRK08251248 PRK08251, PRK08251, short chain dehydrogenase; Pro 7e-07
PRK06182273 PRK06182, PRK06182, short chain dehydrogenase; Val 8e-07
PRK05866293 PRK05866, PRK05866, short chain dehydrogenase; Pro 9e-07
PRK07201657 PRK07201, PRK07201, short chain dehydrogenase; Pro 1e-06
PRK05876275 PRK05876, PRK05876, short chain dehydrogenase; Pro 2e-06
PRK07454241 PRK07454, PRK07454, short chain dehydrogenase; Pro 2e-06
PRK09009235 PRK09009, PRK09009, C factor cell-cell signaling p 2e-06
cd09806258 cd09806, type1_17beta-HSD-like_SDR_c, human estrog 2e-06
PRK05693274 PRK05693, PRK05693, short chain dehydrogenase; Pro 4e-06
PLN02780320 PLN02780, PLN02780, ketoreductase/ oxidoreductase 1e-05
PRK06300299 PRK06300, PRK06300, enoyl-(acyl carrier protein) r 1e-05
PRK08690261 PRK08690, PRK08690, enoyl-(acyl carrier protein) r 2e-05
PRK06194287 PRK06194, PRK06194, hypothetical protein; Provisio 2e-05
PLN02730303 PLN02730, PLN02730, enoyl-[acyl-carrier-protein] r 3e-05
PRK05650270 PRK05650, PRK05650, short chain dehydrogenase; Pro 3e-05
PRK06914280 PRK06914, PRK06914, short chain dehydrogenase; Pro 4e-05
PRK06079252 PRK06079, PRK06079, enoyl-(acyl carrier protein) r 5e-05
PRK07984262 PRK07984, PRK07984, enoyl-(acyl carrier protein) r 8e-05
PRK07791286 PRK07791, PRK07791, short chain dehydrogenase; Pro 1e-04
PRK07825273 PRK07825, PRK07825, short chain dehydrogenase; Pro 1e-04
cd09805281 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta 2e-04
PRK06101240 PRK06101, PRK06101, short chain dehydrogenase; Pro 2e-04
PRK05993277 PRK05993, PRK05993, short chain dehydrogenase; Pro 4e-04
PRK06180277 PRK06180, PRK06180, short chain dehydrogenase; Pro 5e-04
PRK10538248 PRK10538, PRK10538, malonic semialdehyde reductase 8e-04
PRK05872296 PRK05872, PRK05872, short chain dehydrogenase; Pro 9e-04
PRK08945247 PRK08945, PRK08945, putative oxoacyl-(acyl carrier 0.002
PRK08415274 PRK08415, PRK08415, enoyl-(acyl carrier protein) r 0.002
PRK05884223 PRK05884, PRK05884, short chain dehydrogenase; Pro 0.004
>gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs Back     alignment and domain information
 Score =  364 bits (935), Expect = e-129
 Identities = 152/252 (60%), Positives = 187/252 (74%), Gaps = 20/252 (7%)

Query: 12  RWSLQGMTALVTGGTKGLG-------------------NEAELNECLREWKTKCFKVTGS 52
           RW+L+G TALVTGGTKG+G                   N+ EL+ECL EW+ K FKV GS
Sbjct: 1   RWNLEGKTALVTGGTKGIGYAIVEELAGLGAEVYTCARNQKELDECLTEWREKGFKVEGS 60

Query: 53  VCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTNFESA 112
           VCD SSR+ER++LM  V+S F GKLNIL+NN GTN   K   +Y  ED S +MSTNFE+A
Sbjct: 61  VCDVSSRSERQELMDTVASHFGGKLNILVNNAGTN-IRKEAKDYTEEDYSLIMSTNFEAA 119

Query: 113 YHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLAKNLACEWARDNI 172
           YHLS+LAHPLLKASG GNI+ +SSV GV++   G  Y ATKGA+NQL ++LACEWA+DNI
Sbjct: 120 YHLSRLAHPLLKASGNGNIVFISSVAGVIAVPSGAPYGATKGALNQLTRSLACEWAKDNI 179

Query: 173 RINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPGEPKEVSSLVAFLCMPAASYITG 232
           R+N+VAPW I TPL EP +  ++ L++V  RTP++R GEP+EV++LVAFLCMPAASYITG
Sbjct: 180 RVNAVAPWVIATPLVEPVIQQKENLDKVIERTPLKRFGEPEEVAALVAFLCMPAASYITG 239

Query: 233 QTICVDGGFTVN 244
           Q I VDGG T N
Sbjct: 240 QIIAVDGGLTAN 251


This subgroup includes TR-I and TR-II; these proteins are members of the SDR family. TRs catalyze the NADPH-dependent reductions of the 3-carbonyl group of tropinone, to a beta-hydroxyl group. TR-I and TR-II produce different stereoisomers from tropinone, TR-I produces tropine (3alpha-hydroxytropane), and TR-II, produces pseudotropine (sigma-tropine, 3beta-hydroxytropane). SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. Length = 251

>gnl|CDD|181721 PRK09242, PRK09242, tropinone reductase; Provisional Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|187610 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (MDH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235702 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR Back     alignment and domain information
>gnl|CDD|235853 PRK06701, PRK06701, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237219 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187616 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (GlcDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187617 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_coenzyme A_reductase (ChcA)_like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235933 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187622 cd05364, SDR_c11, classical (c) SDR, subgroup 11 Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237100 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187627 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187623 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroid dehydrogenase (7 alpha-HSDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|211705 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236040 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187613 cd05355, SDR_c1, classical (c) SDR, subgroup 1 Back     alignment and domain information
>gnl|CDD|187646 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacyl reductases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181131 PRK07814, PRK07814, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237187 PRK12743, PRK12743, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187641 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl reductase like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187603 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR Back     alignment and domain information
>gnl|CDD|181585 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 Back     alignment and domain information
>gnl|CDD|235712 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|188170 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|187644 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydrogenase (HBDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235816 PRK06500, PRK06500, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187591 cd05330, cyclohexanol_reductase_SDR_c, cyclohexanol reductases, including levodione reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187635 cd08930, SDR_c8, classical (c) SDR, subgroup 8 Back     alignment and domain information
>gnl|CDD|236209 PRK08265, PRK08265, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236116 PRK07856, PRK07856, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187642 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (DHB DH)-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187640 cd08935, mannonate_red_SDR_c, putative D-mannonate oxidoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187587 cd05326, secoisolariciresinol-DH_like_SDR_c, secoisolariciresinol dehydrogenase (secoisolariciresinol-DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187615 cd05357, PR_SDR_c, pteridine reductase (PR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235794 PRK06398, PRK06398, aldose dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187589 cd05328, 3alpha_HSD_SDR_c, alpha hydroxysteroid dehydrogenase (3alpha_HSD), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|188169 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase Back     alignment and domain information
>gnl|CDD|236145 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187609 cd05351, XR_like_SDR_c, xylulose reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187619 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol dehalogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family Back     alignment and domain information
>gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235693 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>gnl|CDD|181605 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235739 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236094 PRK07774, PRK07774, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181668 PRK09135, PRK09135, pteridine reductase; Provisional Back     alignment and domain information
>gnl|CDD|183832 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|181044 PRK07577, PRK07577, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235924 PRK07063, PRK07063, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181508 PRK08628, PRK08628, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187593 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187596 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 1, classical (c) SDR Back     alignment and domain information
>gnl|CDD|236216 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|187649 cd08945, PKR_SDR_c, Polyketide ketoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180408 PRK06114, PRK06114, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|130890 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>gnl|CDD|236056 PRK07576, PRK07576, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180413 PRK06128, PRK06128, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|187662 cd09761, A3DFK9-like_SDR_c, Clostridium thermocellum A3DFK9-like, a putative carbohydrate or polyalcohol metabolizing SDR, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|237188 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180371 PRK06057, PRK06057, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|213929 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Back     alignment and domain information
>gnl|CDD|187647 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|132250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187592 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydrozybenzoate dehydrogenases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187638 cd08933, RDH_SDR_c, retinal dehydrogenase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180773 PRK06949, PRK06949, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187607 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP]reductase (BKR), subgroup 2, classical (c) SDR Back     alignment and domain information
>gnl|CDD|222222 pfam13561, adh_short_C2, Enoyl-(Acyl carrier protein) reductase Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182051 PRK09730, PRK09730, putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|183772 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236190 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|183718 PRK12746, PRK12746, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|181518 PRK08643, PRK08643, acetoin reductase; Validated Back     alignment and domain information
>gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2 Back     alignment and domain information
>gnl|CDD|187621 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), classical (c) SDR Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181297 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235925 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180300 PRK05875, PRK05875, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187664 cd09763, DHRS1-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180771 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180411 PRK06123, PRK06123, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187606 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (BphB)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236074 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187614 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxysteroid dehydrogenases (17beta-HSDs) types -1, -3, and -12, -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183714 PRK12742, PRK12742, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237189 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187597 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) and human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 Back     alignment and domain information
>gnl|CDD|181077 PRK07677, PRK07677, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187584 cd05323, ADH_SDR_c_like, insect type alcohol dehydrogenase (ADH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236110 PRK07831, PRK07831, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183719 PRK12747, PRK12747, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187604 cd05346, SDR_c5, classical (c) SDR, subgroup 5 Back     alignment and domain information
>gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171822 PRK12938, PRK12938, acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|181188 PRK07985, PRK07985, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180818 PRK07062, PRK07062, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235726 PRK06181, PRK06181, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131680 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|236399 PRK09186, PRK09186, flagellin modification protein A; Provisional Back     alignment and domain information
>gnl|CDD|226476 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|183797 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235703 PRK06125, PRK06125, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|177895 PLN02253, PLN02253, xanthoxin dehydrogenase Back     alignment and domain information
>gnl|CDD|181417 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187634 cd08929, SDR_c4, classical (c) SDR, subgroup 4 Back     alignment and domain information
>gnl|CDD|187630 cd05372, ENR_SDR, Enoyl acyl carrier protein (ACP) reductase (ENR), divergent SDR Back     alignment and domain information
>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|132368 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236207 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180766 PRK06940, PRK06940, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187636 cd08931, SDR_c9, classical (c) SDR, subgroup 9 Back     alignment and domain information
>gnl|CDD|237099 PRK12428, PRK12428, 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187611 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)-hydroxyacyl-CoA dehydrogenase-like, classical(c)-like SDRs Back     alignment and domain information
>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 Back     alignment and domain information
>gnl|CDD|131732 TIGR02685, pter_reduc_Leis, pteridine reductase Back     alignment and domain information
>gnl|CDD|187629 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187599 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|168204 PRK05717, PRK05717, oxidoreductase; Validated Back     alignment and domain information
>gnl|CDD|235914 PRK07041, PRK07041, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236210 PRK08267, PRK08267, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187583 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehydrogenase (SDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235608 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR Back     alignment and domain information
>gnl|CDD|180949 PRK07370, PRK07370, enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|223696 COG0623, FabI, Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>gnl|CDD|169389 PRK08339, PRK08339, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187618 cd05360, SDR_c3, classical (c) SDR, subgroup 3 Back     alignment and domain information
>gnl|CDD|181198 PRK08017, PRK08017, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181120 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169390 PRK08340, PRK08340, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183716 PRK12744, PRK12744, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187625 cd05367, SPR-like_SDR_c, sepiapterin reductase (SPR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181020 PRK07533, PRK07533, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180586 PRK06483, PRK06483, dihydromonapterin reductase; Provisional Back     alignment and domain information
>gnl|CDD|187601 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187595 cd05334, DHPR_SDR_c_like, dihydropteridine reductase (DHPR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187535 cd02266, SDR, Short-chain dehydrogenases/reductases (SDR) Back     alignment and domain information
>gnl|CDD|236308 PRK08594, PRK08594, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|212497 cd11731, Lin1944_like_SDR_c, Lin1944 and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236389 PRK09134, PRK09134, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236372 PRK09072, PRK09072, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181324 PRK08251, PRK08251, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180448 PRK06182, PRK06182, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235631 PRK05866, PRK05866, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135637 PRK05876, PRK05876, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181609 PRK09009, PRK09009, C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>gnl|CDD|187666 cd09806, type1_17beta-HSD-like_SDR_c, human estrogenic 17beta-hydroxysteroid dehydrogenase type 1 (type 1 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|166421 PLN02780, PLN02780, ketoreductase/ oxidoreductase Back     alignment and domain information
>gnl|CDD|235776 PRK06300, PRK06300, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|169553 PRK08690, PRK08690, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180458 PRK06194, PRK06194, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178331 PLN02730, PLN02730, enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>gnl|CDD|235545 PRK05650, PRK05650, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235694 PRK06079, PRK06079, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181187 PRK07984, PRK07984, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|236099 PRK07791, PRK07791, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187665 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta-hydroxysteroid dehydrogenase type 2 (type 2 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180399 PRK06101, PRK06101, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180343 PRK05993, PRK05993, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182531 PRK10538, PRK10538, malonic semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|235633 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236357 PRK08945, PRK08945, putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181416 PRK08415, PRK08415, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|135642 PRK05884, PRK05884, short chain dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 251
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 100.0
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK08339263 short chain dehydrogenase; Provisional 100.0
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 100.0
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07478254 short chain dehydrogenase; Provisional 100.0
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK05867253 short chain dehydrogenase; Provisional 100.0
PRK07063260 short chain dehydrogenase; Provisional 100.0
PLN02730303 enoyl-[acyl-carrier-protein] reductase 100.0
PRK06114254 short chain dehydrogenase; Provisional 100.0
KOG0725270 consensus Reductases with broad range of substrate 100.0
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 100.0
PRK08085254 gluconate 5-dehydrogenase; Provisional 100.0
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 100.0
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08589272 short chain dehydrogenase; Validated 100.0
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 100.0
PRK06398258 aldose dehydrogenase; Validated 100.0
PRK08277278 D-mannonate oxidoreductase; Provisional 100.0
PRK07062265 short chain dehydrogenase; Provisional 100.0
PRK07985294 oxidoreductase; Provisional 100.0
PRK07035252 short chain dehydrogenase; Provisional 100.0
PRK06172253 short chain dehydrogenase; Provisional 100.0
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06128300 oxidoreductase; Provisional 100.0
PRK07523255 gluconate 5-dehydrogenase; Provisional 100.0
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK12747252 short chain dehydrogenase; Provisional 100.0
PRK09242257 tropinone reductase; Provisional 100.0
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 100.0
PRK07791286 short chain dehydrogenase; Provisional 100.0
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 100.0
PRK08265261 short chain dehydrogenase; Provisional 100.0
PRK08340259 glucose-1-dehydrogenase; Provisional 100.0
PRK08936261 glucose-1-dehydrogenase; Provisional 100.0
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 100.0
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK07856252 short chain dehydrogenase; Provisional 100.0
PRK12743256 oxidoreductase; Provisional 100.0
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 100.0
PRK07831262 short chain dehydrogenase; Provisional 100.0
PRK08643256 acetoin reductase; Validated 100.0
PRK06124256 gluconate 5-dehydrogenase; Provisional 100.0
PRK06841255 short chain dehydrogenase; Provisional 100.0
PRK06125259 short chain dehydrogenase; Provisional 100.0
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 100.0
PRK08226263 short chain dehydrogenase; Provisional 100.0
PRK07097265 gluconate 5-dehydrogenase; Provisional 100.0
PRK07677252 short chain dehydrogenase; Provisional 100.0
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 100.0
PLN02253280 xanthoxin dehydrogenase 100.0
COG0300265 DltE Short-chain dehydrogenases of various substra 100.0
PRK08303305 short chain dehydrogenase; Provisional 100.0
PRK06484520 short chain dehydrogenase; Validated 100.0
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 100.0
PRK06523260 short chain dehydrogenase; Provisional 100.0
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 100.0
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK06940275 short chain dehydrogenase; Provisional 100.0
PRK07067257 sorbitol dehydrogenase; Provisional 100.0
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK12938246 acetyacetyl-CoA reductase; Provisional 100.0
PRK06483236 dihydromonapterin reductase; Provisional 100.0
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 100.0
PRK07576264 short chain dehydrogenase; Provisional 100.0
PRK06949258 short chain dehydrogenase; Provisional 100.0
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK12939250 short chain dehydrogenase; Provisional 100.0
PRK06701290 short chain dehydrogenase; Provisional 100.0
PRK07890258 short chain dehydrogenase; Provisional 100.0
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 100.0
PRK07814263 short chain dehydrogenase; Provisional 100.0
PRK12937245 short chain dehydrogenase; Provisional 100.0
PRK05717255 oxidoreductase; Validated 100.0
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 100.0
TIGR02415254 23BDH acetoin reductases. One member of this famil 100.0
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 100.0
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 100.0
PRK12742237 oxidoreductase; Provisional 100.0
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 100.0
PRK08213259 gluconate 5-dehydrogenase; Provisional 100.0
PRK08628258 short chain dehydrogenase; Provisional 100.0
PRK06947248 glucose-1-dehydrogenase; Provisional 100.0
PRK12935247 acetoacetyl-CoA reductase; Provisional 100.0
PRK06500249 short chain dehydrogenase; Provisional 100.0
PRK12824245 acetoacetyl-CoA reductase; Provisional 100.0
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 100.0
PRK05872296 short chain dehydrogenase; Provisional 100.0
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK08278273 short chain dehydrogenase; Provisional 100.0
PRK05875276 short chain dehydrogenase; Provisional 100.0
PRK12744257 short chain dehydrogenase; Provisional 100.0
PRK06123248 short chain dehydrogenase; Provisional 100.0
PRK06484 520 short chain dehydrogenase; Validated 100.0
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 100.0
PRK08862227 short chain dehydrogenase; Provisional 100.0
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 100.0
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 100.0
PRK09186256 flagellin modification protein A; Provisional 100.0
PRK07069251 short chain dehydrogenase; Validated 100.0
PRK06138252 short chain dehydrogenase; Provisional 100.0
PRK06057255 short chain dehydrogenase; Provisional 100.0
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 100.0
PRK12746254 short chain dehydrogenase; Provisional 100.0
PRK07774250 short chain dehydrogenase; Provisional 100.0
PRK06198260 short chain dehydrogenase; Provisional 100.0
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 100.0
PRK07577234 short chain dehydrogenase; Provisional 100.0
PRK06139330 short chain dehydrogenase; Provisional 100.0
PRK07060245 short chain dehydrogenase; Provisional 100.0
PRK09134258 short chain dehydrogenase; Provisional 100.0
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK12827249 short chain dehydrogenase; Provisional 100.0
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK05599246 hypothetical protein; Provisional 100.0
PRK05884223 short chain dehydrogenase; Provisional 100.0
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 100.0
PRK08703239 short chain dehydrogenase; Provisional 100.0
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 100.0
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 100.0
PRK05876275 short chain dehydrogenase; Provisional 100.0
PRK09009235 C factor cell-cell signaling protein; Provisional 100.0
PRK07074257 short chain dehydrogenase; Provisional 100.0
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 100.0
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PLN00015308 protochlorophyllide reductase 100.0
PRK07109334 short chain dehydrogenase; Provisional 100.0
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
COG0623259 FabI Enoyl-[acyl-carrier-protein] 100.0
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK06182273 short chain dehydrogenase; Validated 100.0
PRK07832272 short chain dehydrogenase; Provisional 100.0
PRK08324681 short chain dehydrogenase; Validated 100.0
PRK07825273 short chain dehydrogenase; Provisional 100.0
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 100.0
PRK05650270 short chain dehydrogenase; Provisional 100.0
PRK05855582 short chain dehydrogenase; Validated 100.0
PRK12829264 short chain dehydrogenase; Provisional 100.0
PRK05866293 short chain dehydrogenase; Provisional 100.0
PRK12828239 short chain dehydrogenase; Provisional 100.0
PRK08263275 short chain dehydrogenase; Provisional 100.0
PRK07454241 short chain dehydrogenase; Provisional 100.0
PRK07578199 short chain dehydrogenase; Provisional 100.0
PRK05993277 short chain dehydrogenase; Provisional 100.0
PRK06180277 short chain dehydrogenase; Provisional 100.0
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 100.0
PRK06196315 oxidoreductase; Provisional 100.0
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 100.0
PRK07041230 short chain dehydrogenase; Provisional 100.0
PRK09135249 pteridine reductase; Provisional 100.0
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 100.0
KOG1611249 consensus Predicted short chain-type dehydrogenase 100.0
PRK06197306 short chain dehydrogenase; Provisional 100.0
PRK06179270 short chain dehydrogenase; Provisional 100.0
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 99.98
PRK07024257 short chain dehydrogenase; Provisional 99.98
COG1028251 FabG Dehydrogenases with different specificities ( 99.98
PRK07806248 short chain dehydrogenase; Provisional 99.98
PLN02780320 ketoreductase/ oxidoreductase 99.98
PRK06924251 short chain dehydrogenase; Provisional 99.98
PRK06194287 hypothetical protein; Provisional 99.98
PRK10538248 malonic semialdehyde reductase; Provisional 99.98
PRK05854313 short chain dehydrogenase; Provisional 99.97
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
PRK07775274 short chain dehydrogenase; Provisional 99.97
PRK09072263 short chain dehydrogenase; Provisional 99.97
PRK07904253 short chain dehydrogenase; Provisional 99.97
PRK06914280 short chain dehydrogenase; Provisional 99.97
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.97
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.97
PRK08267260 short chain dehydrogenase; Provisional 99.97
KOG1610322 consensus Corticosteroid 11-beta-dehydrogenase and 99.97
PRK05693274 short chain dehydrogenase; Provisional 99.97
KOG1204253 consensus Predicted dehydrogenase [Secondary metab 99.97
PRK06181263 short chain dehydrogenase; Provisional 99.97
PRK07023243 short chain dehydrogenase; Provisional 99.97
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
PRK08251248 short chain dehydrogenase; Provisional 99.97
PRK07201657 short chain dehydrogenase; Provisional 99.97
PRK06482276 short chain dehydrogenase; Provisional 99.97
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.96
PRK07326237 short chain dehydrogenase; Provisional 99.96
PRK07102243 short chain dehydrogenase; Provisional 99.96
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 99.96
KOG1208314 consensus Dehydrogenases with different specificit 99.96
KOG1210331 consensus Predicted 3-ketosphinganine reductase [S 99.96
PRK08264238 short chain dehydrogenase; Validated 99.95
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.95
PRK06101240 short chain dehydrogenase; Provisional 99.95
PRK08177225 short chain dehydrogenase; Provisional 99.95
PRK09291257 short chain dehydrogenase; Provisional 99.95
PRK08017256 oxidoreductase; Provisional 99.95
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 99.95
PRK12367245 short chain dehydrogenase; Provisional 99.94
PRK06953222 short chain dehydrogenase; Provisional 99.94
PRK08219227 short chain dehydrogenase; Provisional 99.93
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.91
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.89
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.85
PLN03209 576 translocon at the inner envelope of chloroplast su 99.84
KOG1478341 consensus 3-keto sterol reductase [Lipid transport 99.81
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.81
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.78
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 99.78
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.78
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.78
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.75
PLN02572442 UDP-sulfoquinovose synthase 99.73
PLN02653340 GDP-mannose 4,6-dehydratase 99.72
PRK06720169 hypothetical protein; Provisional 99.72
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.71
KOG4022236 consensus Dihydropteridine reductase DHPR/QDPR [Am 99.69
PLN00198338 anthocyanidin reductase; Provisional 99.68
PLN02896353 cinnamyl-alcohol dehydrogenase 99.68
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.68
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.68
PLN02650351 dihydroflavonol-4-reductase 99.67
PLN02214342 cinnamoyl-CoA reductase 99.67
PLN02583297 cinnamoyl-CoA reductase 99.66
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.66
PLN02240352 UDP-glucose 4-epimerase 99.65
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 99.65
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.62
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.62
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.61
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.61
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.59
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.58
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.57
PLN02686367 cinnamoyl-CoA reductase 99.57
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.56
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.56
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.56
PLN02427386 UDP-apiose/xylose synthase 99.54
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.52
PLN02260 668 probable rhamnose biosynthetic enzyme 99.51
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.51
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.51
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.5
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.48
PLN02695370 GDP-D-mannose-3',5'-epimerase 99.46
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.46
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.45
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.44
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.43
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.43
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.42
PLN02778298 3,5-epimerase/4-reductase 99.41
PLN02206442 UDP-glucuronate decarboxylase 99.39
PLN02166436 dTDP-glucose 4,6-dehydratase 99.32
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.31
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.27
CHL00194 317 ycf39 Ycf39; Provisional 99.26
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 99.25
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 99.24
PLN02996 491 fatty acyl-CoA reductase 99.24
PRK05865 854 hypothetical protein; Provisional 99.21
PRK07201 657 short chain dehydrogenase; Provisional 99.16
PF08643299 DUF1776: Fungal family of unknown function (DUF177 99.15
PLN02260668 probable rhamnose biosynthetic enzyme 99.15
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 99.05
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 99.04
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.02
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.01
COG3320 382 Putative dehydrogenase domain of multifunctional n 99.0
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 98.96
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 98.93
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 98.85
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 98.8
PRK12320 699 hypothetical protein; Provisional 98.78
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 98.71
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 98.68
PLN00016378 RNA-binding protein; Provisional 98.66
PLN02503 605 fatty acyl-CoA reductase 2 98.63
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 98.49
PRK08309177 short chain dehydrogenase; Provisional 98.33
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 98.3
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 98.27
KOG1221 467 consensus Acyl-CoA reductase [Lipid transport and 98.11
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 98.09
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 97.98
KOG2865 391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 97.88
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.86
COG4982 866 3-oxoacyl-[acyl-carrier protein] 97.84
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 97.8
PRK06732229 phosphopantothenate--cysteine ligase; Validated 97.61
COG2910211 Putative NADH-flavin reductase [General function p 97.54
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 97.45
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 97.42
COG3007398 Uncharacterized paraquat-inducible protein B [Func 97.38
KOG1203411 consensus Predicted dehydrogenase [Carbohydrate tr 97.35
KOG2774366 consensus NAD dependent epimerase [General functio 97.31
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.15
PRK14982340 acyl-ACP reductase; Provisional 96.88
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 96.71
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 96.7
PRK09620229 hypothetical protein; Provisional 96.68
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 96.6
PLN00106323 malate dehydrogenase 96.53
KOG2733 423 consensus Uncharacterized membrane protein [Functi 96.34
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 96.24
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.23
PTZ00325321 malate dehydrogenase; Provisional 96.05
COG2130340 Putative NADP-dependent oxidoreductases [General f 95.8
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.8
PRK05086312 malate dehydrogenase; Provisional 95.58
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 95.5
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 95.28
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 94.92
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 94.61
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 94.22
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 94.14
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 93.85
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 93.61
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 93.49
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 93.41
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 93.26
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.91
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 92.72
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 92.33
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 92.25
PRK15116268 sulfur acceptor protein CsdL; Provisional 92.03
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 91.79
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 91.68
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 91.58
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 91.54
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 91.47
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 91.37
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 91.31
PRK06849 389 hypothetical protein; Provisional 91.25
PRK13982475 bifunctional SbtC-like/phosphopantothenoylcysteine 91.14
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 90.84
PF12241237 Enoyl_reductase: Trans-2-enoyl-CoA reductase catal 90.73
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 90.65
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 90.55
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 90.51
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 90.38
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 90.33
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 89.77
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 89.66
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 89.34
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 88.97
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 88.9
PRK13940414 glutamyl-tRNA reductase; Provisional 88.82
PRK08306296 dipicolinate synthase subunit A; Reviewed 88.71
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 88.6
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 88.34
KOG2013 603 consensus SMT3/SUMO-activating complex, catalytic 88.33
PRK06719157 precorrin-2 dehydrogenase; Validated 88.09
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.99
KOG3851 446 consensus Sulfide:quinone oxidoreductase/flavo-bin 87.68
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 87.46
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 87.25
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.96
COG2894272 MinD Septum formation inhibitor-activating ATPase 86.71
KOG1196343 consensus Predicted NAD-dependent oxidoreductase [ 86.52
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 86.3
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 86.3
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.24
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 86.22
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 86.11
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 85.75
TIGR03029274 EpsG chain length determinant protein tyrosine kin 85.47
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 85.12
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 85.06
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 84.76
PRK12549284 shikimate 5-dehydrogenase; Reviewed 84.67
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 84.23
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.13
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 83.95
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 83.58
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 83.52
PF13614157 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ 83.38
PRK09880343 L-idonate 5-dehydrogenase; Provisional 83.26
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 83.25
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 83.17
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 83.08
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 82.98
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 82.86
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t 82.84
PLN02740381 Alcohol dehydrogenase-like 82.77
PRK12480330 D-lactate dehydrogenase; Provisional 82.48
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 82.47
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 82.24
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 82.18
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 82.16
PF04723150 GRDA: Glycine reductase complex selenoprotein A; I 82.13
PRK13771334 putative alcohol dehydrogenase; Provisional 82.01
PRK13886241 conjugal transfer protein TraL; Provisional 81.9
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 81.47
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like 81.42
PRK06718202 precorrin-2 dehydrogenase; Reviewed 81.4
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 81.1
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 80.85
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 80.76
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=2.2e-48  Score=289.67  Aligned_cols=228  Identities=32%  Similarity=0.438  Sum_probs=203.2

Q ss_pred             cccCCCCCEEEEecCCCCcC-------------------cHHHHHHHHHHHHhcCCeeEEEeccCCCHHHHHHHHHHHHH
Q 041276           11 DRWSLQGMTALVTGGTKGLG-------------------NEAELNECLREWKTKCFKVTGSVCDASSRAEREKLMKQVSS   71 (251)
Q Consensus        11 ~~~~l~~k~vlItGas~giG-------------------~~~~~~~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~i~~   71 (251)
                      ....+..|+++||||++|||                   +....++.+..+... .....+.||++++++++.++++..+
T Consensus         8 ~~~r~~sk~~~vtGg~sGIGrAia~~la~~Garv~v~dl~~~~A~ata~~L~g~-~~h~aF~~DVS~a~~v~~~l~e~~k   86 (256)
T KOG1200|consen    8 VVQRLMSKVAAVTGGSSGIGRAIAQLLAKKGARVAVADLDSAAAEATAGDLGGY-GDHSAFSCDVSKAHDVQNTLEEMEK   86 (256)
T ss_pred             HHHHHhcceeEEecCCchHHHHHHHHHHhcCcEEEEeecchhhHHHHHhhcCCC-CccceeeeccCcHHHHHHHHHHHHH
Confidence            34567889999999999999                   223344444444433 2456789999999999999999999


Q ss_pred             hcCCCccEEEEcccCCCCCCCCCCCCHHHHHHHHHhhhHHHHHHHHHHHHHHH--hCCCceEEEecccccccCCCCChhh
Q 041276           72 LFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTNFESAYHLSQLAHPLLK--ASGAGNIILVSSVCGVLSTNLGTIY  149 (251)
Q Consensus        72 ~~~~~id~lv~~ag~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~m~--~~~~g~iv~vss~~~~~~~~~~~~Y  149 (251)
                      .+ +.++++|||||+.. +..+.....++|+..+.+|+.+.|.++|++.+.|.  ++++++||++||+.+..+.-+...|
T Consensus        87 ~~-g~psvlVncAGItr-D~~Llrmkq~qwd~vi~vNL~gvfl~tqaa~r~~~~~~~~~~sIiNvsSIVGkiGN~GQtnY  164 (256)
T KOG1200|consen   87 SL-GTPSVLVNCAGITR-DGLLLRMKQEQWDSVIAVNLTGVFLVTQAAVRAMVMNQQQGLSIINVSSIVGKIGNFGQTNY  164 (256)
T ss_pred             hc-CCCcEEEEcCcccc-ccceeeccHHHHHHHHHhhchhhHHHHHHHHHHHHHhcCCCceEEeehhhhcccccccchhh
Confidence            99 89999999999986 77788899999999999999999999999999954  4445699999999999999999999


Q ss_pred             HHhHHHHHHHHHHHHHHHccCCeEEEEEecCcccCCCCCCCCCCHHHHHHHhhCCCCCCCCCHHHHHHHHHHHcCCCCCC
Q 041276          150 AATKGAMNQLAKNLACEWARDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPGEPKEVSSLVAFLCMPAASY  229 (251)
Q Consensus       150 ~~sK~a~~~~~~~la~e~~~~~i~v~~i~pG~v~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dva~~~~~l~~~~~~~  229 (251)
                      +++|+++.+|+|++|+|++++|||||.|+||++.|||....  .+.....+...+|++|++++||||..+.||+|+.++|
T Consensus       165 AAsK~GvIgftktaArEla~knIrvN~VlPGFI~tpMT~~m--p~~v~~ki~~~iPmgr~G~~EevA~~V~fLAS~~ssY  242 (256)
T KOG1200|consen  165 AASKGGVIGFTKTAARELARKNIRVNVVLPGFIATPMTEAM--PPKVLDKILGMIPMGRLGEAEEVANLVLFLASDASSY  242 (256)
T ss_pred             hhhcCceeeeeHHHHHHHhhcCceEeEeccccccChhhhhc--CHHHHHHHHccCCccccCCHHHHHHHHHHHhcccccc
Confidence            99999999999999999999999999999999999999876  4677888899999999999999999999999999999


Q ss_pred             ccccEEEeCCCccc
Q 041276          230 ITGQTICVDGGFTV  243 (251)
Q Consensus       230 ~~G~~i~vdgG~~~  243 (251)
                      +||+.+.|+||+.|
T Consensus       243 iTG~t~evtGGl~m  256 (256)
T KOG1200|consen  243 ITGTTLEVTGGLAM  256 (256)
T ss_pred             ccceeEEEeccccC
Confidence            99999999999875



>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG4022 consensus Dihydropteridine reductase DHPR/QDPR [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3007 Uncharacterized paraquat-inducible protein B [Function unknown] Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>PF12241 Enoyl_reductase: Trans-2-enoyl-CoA reductase catalytic region; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>KOG2013 consensus SMT3/SUMO-activating complex, catalytic component UBA2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>PF04723 GRDA: Glycine reductase complex selenoprotein A; InterPro: IPR006812 Found in clostridia, this protein contains one active site selenocysteine and catalyses the reductive deamination of glycine, which is coupled to the esterification of orthophosphate resulting in the formation of ATP [] Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
1xq1_A266 X-Ray Structure Of Putative Tropinone Reducatse Fro 6e-91
1ae1_A273 Tropinone Reductase-I Complex With Nadp Length = 27 2e-72
1ipe_A259 Tropinone Reductase-Ii Complexed With Nadph Length 2e-68
2ae2_A260 Tropinone Reductase-Ii Complexed With Nadp+ And Pse 2e-68
4b79_A242 The Aeropath Project And Pseudomonas Aeruginosa Hig 3e-31
1vl8_A267 Crystal Structure Of Gluconate 5-dehydrogenase (tm0 1e-28
3cxr_A291 Crystal Structure Of Gluconate 5-Dehydrogase From S 9e-25
4ibo_A271 Crystal Structure Of A Putative Gluconate Dehydroge 1e-24
3i3o_A291 2.06 Angstrom Resolution Crystal Structure Of A Sho 1e-24
2hq1_A247 Crystal Structure Of Orf 1438 A Putative GlucoseRIB 2e-24
4g81_D255 Crystal Structure Of A Hexonate Dehydrogenase Ortho 3e-24
3ijr_A291 2.05 Angstrom Resolution Crystal Structure Of A Sho 4e-24
3rsh_A251 Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reduc 1e-23
2zat_A260 Crystal Structure Of A Mammalian Reductase Length = 2e-23
4iin_A271 Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Car 3e-23
3sj7_A252 Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) F 3e-23
3tzc_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 3e-23
3u09_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 3e-23
1x1e_A239 Crystal Structure Of Tt0495 Protein From Thermus Th 4e-23
3tzk_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 6e-23
3o4r_A261 Crystal Structure Of Human DehydrogenaseREDUCTASE ( 8e-23
3gaf_A256 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid De 1e-22
3tzh_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 1e-22
2ph3_A245 Crystal Structure Of 3-oxoacyl-[acyl Carrier Protei 1e-22
3pk0_A262 Crystal Structure Of Short-Chain DehydrogenaseREDUC 3e-22
2wdz_A254 Crystal Structure Of The Short Chain Dehydrogenase 6e-22
1rwb_A261 Cooperative Effect Of Two Surface Amino Acid Mutati 1e-21
3osu_A246 Crystal Structure Of The 3-Oxoacyl-Acyl Carrier Pro 3e-21
3op4_A248 Crystal Structure Of Putative 3-Ketoacyl-(Acyl-Carr 3e-21
2uvd_A246 The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier 3e-21
1gee_A261 Crystal Structure Of Glucose Dehydrogenase Mutant Q 3e-21
1gco_A261 Crystal Structure Of Glucose Dehydrogenase Complexe 4e-21
3ftp_A270 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 4e-21
1g6k_A261 Crystal Structure Of Glucose Dehydrogenase Mutant E 5e-21
1ahi_A255 7 Alpha-Hydroxysteroid Dehydrogenase Complexed With 6e-21
3emk_A246 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGEN 6e-21
3enn_A249 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGEN 7e-21
1yxm_A303 Crystal Structure Of Peroxisomal Trans 2-Enoyl Coa 1e-20
3ay6_A269 Crystal Structure Of Bacillus Megaterium Glucose De 1e-20
3aus_A269 Crystal Structure Of Bacillus Megaterium Glucose De 1e-20
2nm0_A253 Crystal Structure Of Sco1815: A Beta-Ketoacyl-Acyl 2e-20
3ay7_A269 Crystal Structure Of Bacillus Megaterium Glucose De 2e-20
2b4q_A276 Pseudomonas Aeruginosa RhlgNADP ACTIVE-Site Complex 2e-20
4dml_A269 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Syn 2e-20
1i01_A244 Crystal Structure Of Beta-Ketoacyl [acyl Carrier Pr 3e-20
3uf0_A273 Crystal Structure Of A Putative Nad(P) Dependent Gl 3e-20
1iy8_A267 Crystal Structure Of Levodione Reductase Length = 2 4e-20
1q7c_A244 The Structure Of Betaketoacyl-[acp] Reductase Y151f 7e-20
3ai1_A263 The Crystal Structure Of L-Sorbose Reductase From G 1e-19
4afn_A269 Crystal Structure Of 3-ketoacyl-(acyl-carrier-prote 1e-19
2pnf_A248 Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl- 2e-19
3awd_A260 Crystal Structure Of Gox2181 Length = 260 2e-19
3r1i_A276 Crystal Structure Of A Short-Chain Type Dehydrogena 3e-19
2rhr_B277 P94l Actinorhodin Ketordeuctase Mutant, With Nadph 3e-19
3csd_B281 Actinorhodin Polyketide Ketoreductase Mutant P94l B 3e-19
3ai3_A263 The Crystal Structure Of L-Sorbose Reductase From G 4e-19
1w4z_A281 Structure Of Actinorhodin Polyketide (Actiii) Reduc 5e-19
2rh4_A277 Actinorhodin Ketoreductase, Actkr, With Nadph And I 5e-19
1x7g_A261 Actinorhodin Polyketide Ketoreductase, Act Kr, With 6e-19
3lyl_A247 Structure Of 3-Oxoacyl-Acylcarrier Protein Reductas 7e-19
4dbz_A281 Crystal Structure Of V151l Actinorhodin Polyketide 8e-19
4dc1_A281 Crystal Structure Of Y202f Actinorhodin Polyketide 9e-19
1edo_A244 The X-Ray Structure Of Beta-Keto Acyl Carrier Prote 1e-18
2hsd_A253 The Refined Three-Dimensional Structure Of 3alpha,2 1e-18
3grp_A266 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl- 1e-18
2pd6_A264 Structure Of Human Hydroxysteroid Dehydrogenase Typ 2e-18
3f9i_A249 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 2e-18
2cfc_A250 Structural Basis For Stereo Selectivity In The (R)- 2e-18
4dc0_A281 Crystal Structure Of F189w Actinorhodin Polyketide 3e-18
2d1y_A256 Crystal Structure Of Tt0321 From Thermus Thermophil 4e-18
2c07_A285 Oxoacyl-Acp Reductase Of Plasmodium Falciparum Leng 4e-18
3v2h_A281 The Crystal Structure Of D-Beta-Hydroxybutyrate Deh 4e-18
2ew8_A249 Crystal Structure Of The (s)-specific 1-phenylethan 5e-18
1cyd_A244 Carbonyl Reductase Complexed With Nadph And 2-Propa 5e-18
2q2q_A255 Structure Of D-3-Hydroxybutyrate Dehydrogenase From 7e-18
4fn4_A254 Short-chain Nad(h)-dependent Dehydrogenase/reductas 1e-17
4dqx_A277 Crystal Structure Of A Short Chain Dehydrogenase Fr 1e-17
3oic_A258 Crystal Structure Of Enoyl-Acp Reductases Iii (Fabl 3e-17
1hdc_A254 Mechanism Of Inhibition Of 3alpha,20beta-Hydroxyste 3e-17
2yz7_A260 X-Ray Analyses Of 3-Hydroxybutyrate Dehydrogenase F 3e-17
3gk3_A269 Crystal Structure Of Acetoacetyl-Coa Reductase From 4e-17
3gdf_A267 Crystal Structure Of The Nadp-Dependent Mannitol De 5e-17
1uzl_A247 Maba From Mycobacterium Tuberculosis Length = 247 7e-17
4iiu_A267 Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Car 7e-17
3vtz_A269 Structure Of Thermoplasma Volcanium Aldohexose Dehy 9e-17
2ntn_A267 Crystal Structure Of Maba-c60v/g139a/s144l Length = 1e-16
3ak4_A263 Crystal Structure Of Nadh-Dependent Quinuclidinone 1e-16
2zk7_A257 Structure Of A C-Terminal Deletion Mutant Of Thermo 1e-16
1nff_A260 Crystal Structure Of Rv2002 Gene Product From Mycob 1e-16
2dtd_A264 Structure Of Thermoplasma Acidophilum Aldohexose De 1e-16
1uzm_A247 Maba From Mycobacterium Tuberculosis Length = 247 1e-16
3ctm_A279 Crystal Structure Of A Carbonyl Reductase From Cand 2e-16
1nxq_A251 Crystal Structure Of R-Alcohol Dehydrogenase (Radh) 2e-16
3un1_A260 Crystal Structure Of An Oxidoreductase From Sinorhi 2e-16
4hp8_A247 Crystal Structure Of A Putative 2-Deoxy-D-Gluconate 2e-16
3tzq_B271 Crystal Structure Of A Short-Chain Type Dehydrogena 2e-16
3n74_A261 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 3e-16
1zjy_A251 Structure Of R-Specific Alcohol Dehydrogenase (Muta 3e-16
1h5q_A265 Mannitol Dehydrogenase From Agaricus Bisporus Lengt 4e-16
3oec_A317 Crystal Structure Of Carveol Dehydrogenase From Myc 4e-16
1o5i_A249 Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protei 5e-16
3rih_A293 Crystal Structure Of A Putative Short Chain Dehydro 7e-16
1pr9_A244 Human L-Xylulose Reductase Holoenzyme Length = 244 1e-15
1zem_A262 Crystal Structure Of Nad+-Bound Xylitol Dehydrogena 1e-15
1nfr_A260 Rv2002 Gene Product From Mycobacterium Tuberculosis 2e-15
1fjh_A257 The Crystal Structure Of 3-Alpha-Hydroxysteroid Deh 2e-15
1uls_A245 Crystal Structure Of Tt0140 From Thermus Thermophil 2e-15
1wmb_A260 Crystal Structure Of Nad Dependent D-3-Hydroxybutyl 4e-15
3u0b_A454 Crystal Structure Of An Oxidoreductase From Mycobac 4e-15
1spx_A278 Crystal Structure Of Glucose Dehydrogenase Of Caeno 5e-15
1k2w_A256 Crystal Structure Of Sorbitol Dehydrogenase From R. 6e-15
2cf2_E226 Architecture Of Mammalian Fatty Acid Synthase Lengt 8e-15
2ztm_A260 T190s Mutant Of D-3-Hydroxybutyrate Dehydrogenase L 1e-14
2ztu_A260 T190a Mutant Of D-3-Hydroxybutyrate Dehydrogenase C 1e-14
3d3w_A244 Structure Of L-Xylulose Reductase With Bound Coenzy 1e-14
3i4f_A264 Structure Of Putative 3-oxoacyl-reductase From Baci 2e-14
4egf_A266 Crystal Structure Of A L-Xylulose Reductase From My 2e-14
3d3w_B245 Structure Of L-Xylulose Reductase With Bound Coenzy 3e-14
3ezl_A256 Crystal Structure Of Acetyacetyl-Coa Reductase From 3e-14
2a4k_A263 3-Oxoacyl-[acyl Carrier Protein] Reductase From The 3e-14
4imr_A275 Crystal Structure Of 3-oxoacyl (acyl-carrier-protei 3e-14
4e3z_A272 Crystal Structure Of A Oxidoreductase From Rhizobiu 5e-14
1xhl_A297 Crystal Structure Of Putative Tropinone Reductase-I 5e-14
3imf_A257 1.99 Angstrom Resolution Crystal Structure Of A Sho 6e-14
3sju_A279 Hedamycin Polyketide Ketoreductase Bound To Nadph L 7e-14
4fgs_A273 Crystal Structure Of A Probable Dehydrogenase Prote 9e-14
3uxy_A266 The Crystal Structure Of Short Chain Dehydrogenase 9e-14
2bgk_A278 X-Ray Structure Of Apo-Secoisolariciresinol Dehydro 1e-13
3svt_A281 Structure Of A Short-Chain Type DehydrogenaseREDUCT 2e-13
3nug_A247 Crystal Structure Of Wild Type Tetrameric Pyridoxal 2e-13
4eso_A255 Crystal Structure Of A Putative Oxidoreductase Prot 2e-13
3vc7_A254 Crystal Structure Of A Putative Oxidoreductase From 2e-13
2dkn_A255 Crystal Structure Of The 3-alpha-hydroxysteroid Deh 3e-13
4gkb_A258 Crystal Structure Of A Short Chain Dehydrogenase Ho 4e-13
1hxh_A253 Comamonas Testosteroni 3beta17BETA HYDROXYSTEROID D 4e-13
1ybv_A283 Structure Of Trihydroxynaphthalene Reductase In Com 5e-13
1doh_A283 Structure Of Trihydroxynaphthalene Reductase In Com 5e-13
3v2g_A271 Crystal Structure Of A DehydrogenaseREDUCTASE FROM 5e-13
3pgx_A280 Crystal Structure Of A Putative Carveol Dehydrogena 6e-13
3o38_A266 Crystal Structure Of A Short Chain Dehydrogenase Fr 8e-13
1xkq_A280 Crystal Structure Of Short-Chain DehydrogenaseREDUC 9e-13
3tox_A280 Crystal Structure Of A Short Chain Dehydrogenase In 2e-12
3ndr_A247 Crystal Structure Of Tetrameric Pyridoxal 4-Dehydro 2e-12
3v8b_A283 Crystal Structure Of A 3-Ketoacyl-Acp Reductase Fro 2e-12
3icc_A255 Crystal Structure Of A Putative 3-Oxoacyl-(Acyl Car 3e-12
4iqg_C271 Crystal Structure Of Bpro0239 Oxidoreductase From P 5e-12
3gvc_A277 Crystal Structure Of Probable Short-Chain Dehydroge 6e-12
4fc6_A277 Studies On Dcr Shed New Light On Peroxisomal Beta-O 7e-12
3ged_A247 Fingerprint And Structural Analysis Of A Apo Scor E 7e-12
3r3s_A294 Structure Of The Ygha Oxidoreductase From Salmonell 8e-12
2ag5_A246 Crystal Structure Of Human Dhrs6 Length = 246 9e-12
4ixt_A254 Structure Of A 37-fold Mutant Of Halohydrin Dehalog 2e-11
3edm_A259 Crystal Structure Of A Short Chain Dehydrogenase Fr 2e-11
2fwm_X250 Crystal Structure Of E. Coli Enta, A 2,3-Dihydrodih 3e-11
3q6i_A446 Crystal Structure Of Fabg4 And Coenzyme Binary Comp 3e-11
1p33_A289 Pteridine Reductase From Leishmania Tarentolae Comp 3e-11
4fw8_A454 Crystal Structure Of Fabg4 Complexed With Coenzyme 3e-11
3a28_C258 Crystal Structure Of L-2,3-Butanediol Dehydrogenase 3e-11
3v1t_C462 Crystal Structure Of A Putative Ketoacyl Reductase 3e-11
3m1l_A432 Crystal Strucutre Of A C-Terminal Trunacted Mutant 3e-11
3lls_A475 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 4e-11
3qiv_A253 Crystal Structure Of A Putative Short-Chain Dehydro 4e-11
3oml_A 613 Structure Of Full-Length Peroxisomal Multifunctiona 4e-11
3u5t_A267 The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Pr 4e-11
3sx2_A278 Crystal Structure Of A Putative 3-Ketoacyl-(Acyl-Ca 5e-11
3tsc_A277 Crystal Structure Of Short Chain Dehydrogenase Map_ 7e-11
3uve_A286 Crystal Structure Of Carveol Dehydrogenase ((+)-Tra 9e-11
3oif_A266 Crystal Structure Of Enoyl-Acp Reductases I (Fabi) 1e-10
1pwx_A254 Crystal Structure Of The Haloalcohol Dehalogenase H 1e-10
1w6u_A302 Structure Of Human Decr Ternary Complex Length = 30 2e-10
1bdb_A277 Cis-Biphenyl-2,3-Dihydrodiol-2,3-Dehydrogenase From 2e-10
2y93_A281 Crystal Structure Of Cis-Biphenyl-2,3-Dihydrodiol-2 2e-10
4e4y_A244 The Crystal Structure Of A Short Chain Dehydrogenas 3e-10
3rkr_A262 Crystal Structure Of A Metagenomic Short-Chain Oxid 4e-10
1yde_A270 Crystal Structure Of Human Retinal Short-Chain Dehy 4e-10
2xox_A288 Crystal Structure Of Pteridine Reductase (Ptr1) Fro 5e-10
3t7c_A299 Crystal Structure Of Carveol Dehydrogenase From Myc 5e-10
2z1n_A260 Crystal Structure Of Ape0912 From Aeropyrum Pernix 6e-10
1geg_A256 Cryatal Structure Analysis Of Meso-2,3-Butanediol D 6e-10
1w73_A302 Binary Structure Of Human Decr Solved By Semet Sad. 8e-10
4fs3_A256 Crystal Structure Of Staphylococcus Aureus Enoyl-Ac 9e-10
2et6_A 604 (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candid 2e-09
3t4x_A267 Short Chain DehydrogenaseREDUCTASE FAMILY OXIDOREDU 2e-09
4all_A277 Crystal Structure Of S. Aureus Fabi In Complex With 3e-09
2qq5_A260 Crystal Structure Of Human Sdr Family Member 1 Leng 3e-09
3gnt_A256 Crystal Structure Of The Staphylococcus Aureus Enoy 3e-09
4ali_A282 Crystal Structure Of S. Aureus Fabi In Complex With 3e-09
3gns_A260 Crystal Structure Of The Staphylococcus Aureus Enoy 3e-09
3is3_A270 Crystal Structure Of 17beta-Hydroxysteroid Dehydrog 4e-09
3s55_A281 Crystal Structure Of A Putative Short-Chain Dehydro 6e-09
1zmo_A244 Apo Structure Of Haloalcohol Dehalogenase Hhea Of A 8e-09
3itd_A270 Crystal Structure Of An Inactive 17beta-Hydroxyster 1e-08
4e6p_A259 Crystal Structure Of A Probable Sorbitol Dehydrogen 1e-08
1e7w_A291 One Active Site, Two Modes Of Reduction Correlate T 2e-08
3rku_A287 Substrate Fingerprint And The Structure Of Nadp+ De 2e-08
1e92_A288 Pteridine Reductase 1 From Leishmania Major Complex 2e-08
2qhx_A328 Structure Of Pteridine Reductase From Leishmania Ma 2e-08
1w0c_A307 Inhibition Of Leishmania Major Pteridine Reductase 2e-08
1zbq_A327 Crystal Structure Of Human 17-beta-hydroxysteroid D 3e-08
3ojf_A257 Crystal Structure Of The Bacillus Cereus Enoyl-Acyl 6e-08
2qio_A256 X-Ray Structure Of Enoyl-Acyl Carrier Protein Reduc 8e-08
2bd0_A244 Chlorobium Tepidum Sepiapterin Reductase Complexed 8e-08
1mxf_A276 Crystal Structure Of Inhibitor Complex Of Putative 1e-07
1ja9_A274 Crystal Structure Of 1,3,6,8-Tetrahydroxynaphthalen 1e-07
3afm_A258 Crystal Structure Of Aldose Reductase A1-R Responsi 2e-07
1mxh_A276 Crystal Structure Of Substrate Complex Of Putative 2e-07
1e6w_A260 Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Co 3e-07
1e3s_A261 Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Co 3e-07
4da9_A280 Crystal Structure Of Putative Short-Chain Dehydroge 3e-07
3asu_A248 Crystal Structure Of Serine Dehydrogenase From Esch 3e-07
4h15_A261 Crystal Structure Of A Short Chain Alcohol Dehydrog 4e-07
3ksu_A262 Crystal Structure Of Short-Chain Dehydrogenase From 5e-07
4bb5_A292 Free-Wilson And Structural Approaches To Co-Optimis 5e-07
4bb6_A292 Free-Wilson And Structural Approaches To Co-Optimis 5e-07
1ulu_A261 Crystal Structure Of Tt0143 From Thermus Thermophil 5e-07
3uwr_A286 Crystal Structure Of Carveol Dehydrogenase From Myc 6e-07
4hfr_A272 Human 11beta-Hydroxysteroid Dehydrogenase Type 1 In 6e-07
2yw9_A261 Crystal Structure Of Tt0143 From Thermus Thermophil 7e-07
1e3w_A261 Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Co 8e-07
1xu7_A286 Crystal Structure Of The Interface Open Conformatio 8e-07
2rbe_A275 The Discovery Of 2-Anilinothiazolones As 11beta-Hsd 8e-07
2ilt_A275 Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) W 9e-07
3pdj_A273 Crystal Structure Of Human 11-Beta-Hydroxysteroid D 9e-07
3d5q_A272 Crystal Structure Of 11b-Hsd1 In Complex With Triaz 9e-07
2irw_A264 Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) W 9e-07
2bel_A283 Structure Of Human 11-Beta-Hydroxysteroid Dehydroge 1e-06
1cwu_A296 Brassica Napus Enoyl Acp Reductase A138g Mutant Com 1e-06
3ch6_A286 Crystal Structure Of 11beta-Hsd1 Double Mutant (L26 1e-06
2nwq_A272 Short Chain Dehydrogenase From Pseudomonas Aerugino 1e-06
3ppi_A281 Crystal Structure Of 3-Hydroxyacyl-Coa Dehydrogenas 1e-06
3tjr_A301 Crystal Structure Of A Rv0851c Ortholog Short Chain 2e-06
3ucx_A264 The Structure Of A Short Chain Dehydrogenase From M 2e-06
3lz6_A263 Guinea Pig 11beta Hydroxysteroid Dehydrogenase With 2e-06
1xse_A295 Crystal Structure Of Guinea Pig 11beta-Hydroxystero 3e-06
3g49_A277 N-(Pyridin-2-Yl) Arylsulfonamide Inhibitors Of 11b- 3e-06
3dwf_A276 Crystal Structure Of The Guinea Pig 11beta-Hydroxys 3e-06
1gz6_A319 (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat 3e-06
2gdz_A267 Crystal Structure Of 15-Hydroxyprostaglandin Dehydr 4e-06
2jap_A247 Clavulanic Acid Dehydrogenase: Structural And Bioch 4e-06
1eno_A312 Brassica Napus Enoyl Acp ReductaseNAD BINARY COMPLE 6e-06
3lf1_A265 Apo Structure Of The Short Chain Oxidoreductase Q9h 6e-06
1d7o_A297 Crystal Structure Of Brassica Napus Enoyl Acyl Carr 6e-06
2ehd_A234 Crystal Structure Analysis Of Oxidoreductase Length 7e-06
3m1a_A281 The Crystal Structure Of A Short-Chain Dehydrogenas 8e-06
2p91_A285 Crystal Structure Of Enoyl-[acyl-Carrier-Protein] R 8e-06
1u7t_A261 Crystal Structure Of AbadHSD10 WITH A BOUND INHIBIT 9e-06
1so8_A261 Abeta-bound Human Abad Structure [also Known As 3-h 9e-06
2o23_A265 The Structure Of Wild-Type Human Hadh2 (17beta-Hydr 1e-05
3uce_A223 Crystal Structure Of A Small-Chain Dehydrogenase In 1e-05
1yb1_A272 Crystal Structure Of Human 17-Beta-Hydroxysteroid D 1e-05
3jq7_A288 Crystal Structure Of Pteridine Reductase 1 (Ptr1) F 1e-05
3jq7_B288 Crystal Structure Of Pteridine Reductase 1 (Ptr1) F 1e-05
3bmc_A288 Structure Of Pteridine Reductase 1 (Ptr1) From Tryp 1e-05
2c7v_A268 Structure Of Trypanosoma Brucei Pteridine Reductase 1e-05
3bmc_B288 Structure Of Pteridine Reductase 1 (Ptr1) From Tryp 1e-05
2wd7_B268 Pteridine Reductase 1 (Ptr1) From Trypanosoma Bruce 1e-05
2wd7_A268 Pteridine Reductase 1 (Ptr1) From Trypanosoma Bruce 2e-05
2jah_A247 Biochemical And Structural Analysis Of The Clavulan 3e-05
1y5m_A276 The Crystal Structure Of Murine 11b-Hydroxysteroid 4e-05
3ek2_A271 Crystal Structure Of Eonyl-(Acyl Carrier Protein) R 5e-05
3gmd_A264 Structure-Based Design Of 7-Azaindole-Pyrrolidines 6e-05
2jjy_A268 Crystal Structure Of Francisella Tularensis Enoyl R 6e-05
3nrc_A280 Crystal Stucture Of The Francisella Tularensis Enoy 6e-05
3qlj_A322 Crystal Structure Of A Short Chain Dehydrogenase Fr 6e-05
3e9n_A245 Crystal Structure Of A Putative Short-Chain Dehydro 7e-05
1qsg_A265 Crystal Structure Of Enoyl Reductase Inhibition By 7e-05
3pjd_A270 Structure Of Enr G93a Mutant-Nad+-Triclosan Complex 8e-05
3pjf_A270 Structure Of Enr G93v Mutant-Nad+-Triclosan Complex 8e-05
1dfg_A261 X-Ray Structure Of Escherichia Coli Enoyl Reductase 8e-05
1c14_A262 Crystal Structure Of E Coli Enoyl Reductase-nad+-tr 8e-05
3pje_A270 Structure Of Enr G93s Mutant-Nad+-Triclosan Complex 8e-05
4eit_A276 Crystal Structure Of An Enoyl-(Acyl Carrier Protein 2e-04
3i1j_A247 Structure Of A Putative Short Chain Dehydrogenase F 2e-04
3grk_A293 Crystal Structure Of Short Chain Dehydrogenase Redu 4e-04
3g1t_A258 Crystal Structure Of Short Chain Dehydrogenase From 5e-04
>pdb|1XQ1|A Chain A, X-Ray Structure Of Putative Tropinone Reducatse From Arabidopsis Thaliana Gene At1g07440 Length = 266 Back     alignment and structure

Iteration: 1

Score = 330 bits (845), Expect = 6e-91, Method: Compositional matrix adjust. Identities = 166/261 (63%), Positives = 196/261 (75%), Gaps = 21/261 (8%) Query: 8 DRQDRWSLQGMTALVTGGTKGLG-------------------NEAELNECLREWKTKCFK 48 ++ RWSL+ T LVTGGTKG+G NE ELNECL +W+ K F+ Sbjct: 5 EQSQRWSLKAKTVLVTGGTKGIGHAIVEEFAGFGAVIHTCARNEYELNECLSKWQKKGFQ 64 Query: 49 VTGSVCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTN 108 VTGSVCDAS R EREKLM+ VSS+F GKL+ILINN+G +KPT++Y AED SF +STN Sbjct: 65 VTGSVCDASLRPEREKLMQTVSSMFGGKLDILINNLGA-IRSKPTLDYTAEDFSFHISTN 123 Query: 109 FESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLAKNLACEWA 168 ESAYHLSQLAHPLLKASG GNII +SS+ GV+S ++G+IY+ATKGA+NQLA+NLACEWA Sbjct: 124 LESAYHLSQLAHPLLKASGCGNIIFMSSIAGVVSASVGSIYSATKGALNQLARNLACEWA 183 Query: 169 RDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPGEPKEVSSLVAFLCMPAAS 228 D IR N+VAP I TPL E DE F + V R P+ R GEP+EVSSLVAFLCMPAAS Sbjct: 184 SDGIRANAVAPAVIATPLAEAVYDDE-FKKVVISRKPLGRFGEPEEVSSLVAFLCMPAAS 242 Query: 229 YITGQTICVDGGFTVNGFFFR 249 YITGQTICVDGG TVNGF ++ Sbjct: 243 YITGQTICVDGGLTVNGFSYQ 263
>pdb|1AE1|A Chain A, Tropinone Reductase-I Complex With Nadp Length = 273 Back     alignment and structure
>pdb|1IPE|A Chain A, Tropinone Reductase-Ii Complexed With Nadph Length = 259 Back     alignment and structure
>pdb|2AE2|A Chain A, Tropinone Reductase-Ii Complexed With Nadp+ And Pseudotropine Length = 260 Back     alignment and structure
>pdb|4B79|A Chain A, The Aeropath Project And Pseudomonas Aeruginosa High-throughput Crystallographic Studies For Assessment Of Potential Targets In Early Stage Drug Discovery. Length = 242 Back     alignment and structure
>pdb|1VL8|A Chain A, Crystal Structure Of Gluconate 5-dehydrogenase (tm0441) From Thermotoga Maritima At 2.07 A Resolution Length = 267 Back     alignment and structure
>pdb|3CXR|A Chain A, Crystal Structure Of Gluconate 5-Dehydrogase From Streptococcus Suis Type 2 Length = 291 Back     alignment and structure
>pdb|4IBO|A Chain A, Crystal Structure Of A Putative Gluconate Dehydrogenase From Agrobacterium Tumefaciens (Target Efi-506446) Length = 271 Back     alignment and structure
>pdb|3I3O|A Chain A, 2.06 Angstrom Resolution Crystal Structure Of A Short Chain Dehydrogenase From Bacillus Anthracis Str. 'ames Ancestor' In Complex With Nad-acetone Length = 291 Back     alignment and structure
>pdb|2HQ1|A Chain A, Crystal Structure Of Orf 1438 A Putative GlucoseRIBITOL Dehydrogenase From Clostridium Thermocellum Length = 247 Back     alignment and structure
>pdb|4G81|D Chain D, Crystal Structure Of A Hexonate Dehydrogenase Ortholog (Target Efi- 506402 From Salmonella Enterica, Unliganded Structure Length = 255 Back     alignment and structure
>pdb|3IJR|A Chain A, 2.05 Angstrom Resolution Crystal Structure Of A Short Chain Dehydrogenase From Bacillus Anthracis Str. 'ames Ancestor' In Complex With Nad+ Length = 291 Back     alignment and structure
>pdb|3RSH|A Chain A, Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reductase (Fabg) From Vibrio Cholerae O1 Complexed With Nadp+ (Space Group P62) Length = 251 Back     alignment and structure
>pdb|2ZAT|A Chain A, Crystal Structure Of A Mammalian Reductase Length = 260 Back     alignment and structure
>pdb|4IIN|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Carrier Protein]reductase From Helicobacter Pylori 26695 Complexed With Nad+ Length = 271 Back     alignment and structure
>pdb|3SJ7|A Chain A, Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) From Staphylococcus Aureus Complex With Nadph Length = 252 Back     alignment and structure
>pdb|3TZC|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(Y155f) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3U09|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92d) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|1X1E|A Chain A, Crystal Structure Of Tt0495 Protein From Thermus Thermophilus Hb8 Length = 239 Back     alignment and structure
>pdb|3TZK|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3O4R|A Chain A, Crystal Structure Of Human DehydrogenaseREDUCTASE (SDR FAMILY) MEMBER 4 (Dhrs4) Length = 261 Back     alignment and structure
>pdb|3GAF|A Chain A, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid Dehydrogenase From Brucella Melitensis Length = 256 Back     alignment and structure
>pdb|3TZH|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(F187a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|2PH3|A Chain A, Crystal Structure Of 3-oxoacyl-[acyl Carrier Protein] Reductase Ttha0415 From Thermus Thermophilus Length = 245 Back     alignment and structure
>pdb|3PK0|A Chain A, Crystal Structure Of Short-Chain DehydrogenaseREDUCTASE SDR FROM Mycobacterium Smegmatis Length = 262 Back     alignment and structure
>pdb|2WDZ|A Chain A, Crystal Structure Of The Short Chain Dehydrogenase Galactitol-Dehydrogenase (Gatdh) Of Rhodobacter Sphaeroides In Complex With Nad+ And 1,2-Pentandiol Length = 254 Back     alignment and structure
>pdb|1RWB|A Chain A, Cooperative Effect Of Two Surface Amino Acid Mutations (Q252l And E170k) Of Glucose Dehydrogenase From Bacillus Megaterium Iwg3 For The Stabilization Of Oligomeric State Length = 261 Back     alignment and structure
>pdb|3OSU|A Chain A, Crystal Structure Of The 3-Oxoacyl-Acyl Carrier Protein Reductase, Fabg, From Staphylococcus Aureus Length = 246 Back     alignment and structure
>pdb|3OP4|A Chain A, Crystal Structure Of Putative 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Vibrio Cholerae O1 Biovar Eltor Str. N16961 In Complex With Nadp+ Length = 248 Back     alignment and structure
>pdb|2UVD|A Chain A, The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier Protein) Reductase From Bacillus Anthracis (Ba3989) Length = 246 Back     alignment and structure
>pdb|1GEE|A Chain A, Crystal Structure Of Glucose Dehydrogenase Mutant Q252l Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|1GCO|A Chain A, Crystal Structure Of Glucose Dehydrogenase Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|3FTP|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Burkholderia Pseudomallei At 2.05 A Resolution Length = 270 Back     alignment and structure
>pdb|1G6K|A Chain A, Crystal Structure Of Glucose Dehydrogenase Mutant E96a Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|1AHI|A Chain A, 7 Alpha-Hydroxysteroid Dehydrogenase Complexed With Nadh And 7-Oxo Glycochenodeoxycholic Acid Length = 255 Back     alignment and structure
>pdb|3EMK|A Chain A, 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE From Brucella Melitensis Length = 246 Back     alignment and structure
>pdb|3ENN|A Chain A, 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE FROM BRUCELLA Melitensis (P43212) Length = 249 Back     alignment and structure
>pdb|1YXM|A Chain A, Crystal Structure Of Peroxisomal Trans 2-Enoyl Coa Reductase Length = 303 Back     alignment and structure
>pdb|3AY6|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 A258f Mutant In Complex With Nadh And D-Glucose Length = 269 Back     alignment and structure
>pdb|3AUS|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 In Ligand-Free Form Length = 269 Back     alignment and structure
>pdb|2NM0|A Chain A, Crystal Structure Of Sco1815: A Beta-Ketoacyl-Acyl Carrier Protein Reductase From Streptomyces Coelicolor A3(2) Length = 253 Back     alignment and structure
>pdb|3AY7|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 G259a Mutant Length = 269 Back     alignment and structure
>pdb|2B4Q|A Chain A, Pseudomonas Aeruginosa RhlgNADP ACTIVE-Site Complex Length = 276 Back     alignment and structure
>pdb|4DML|A Chain A, 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Synechococcus Elongatus Pcc 7942 Length = 269 Back     alignment and structure
>pdb|1I01|A Chain A, Crystal Structure Of Beta-Ketoacyl [acyl Carrier Protein] Reductase From E. Coli. Length = 244 Back     alignment and structure
>pdb|3UF0|A Chain A, Crystal Structure Of A Putative Nad(P) Dependent Gluconate 5- Dehydrogenase From Beutenbergia Cavernae(Efi Target Efi-502044) With Bound Nadp (Low Occupancy) Length = 273 Back     alignment and structure
>pdb|1IY8|A Chain A, Crystal Structure Of Levodione Reductase Length = 267 Back     alignment and structure
>pdb|1Q7C|A Chain A, The Structure Of Betaketoacyl-[acp] Reductase Y151f Mutant In Complex With Nadph Fragment Length = 244 Back     alignment and structure
>pdb|3AI1|A Chain A, The Crystal Structure Of L-Sorbose Reductase From Gluconobacter Frateurii Complexed With Nadph And L-Sorbose Reveals The Structure Bases Of Its Catalytic Mechanism And High Substrate Selectivity Length = 263 Back     alignment and structure
>pdb|4AFN|A Chain A, Crystal Structure Of 3-ketoacyl-(acyl-carrier-protein) Reductase (fabg) From Pseudomonas Aeruginosa At 2.3a Resolution Length = 269 Back     alignment and structure
>pdb|2PNF|A Chain A, Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl-carrier Protein) Reductase Length = 248 Back     alignment and structure
>pdb|3AWD|A Chain A, Crystal Structure Of Gox2181 Length = 260 Back     alignment and structure
>pdb|3R1I|A Chain A, Crystal Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Marinum Length = 276 Back     alignment and structure
>pdb|2RHR|B Chain B, P94l Actinorhodin Ketordeuctase Mutant, With Nadph And Inhibitor Emodin Length = 277 Back     alignment and structure
>pdb|3CSD|B Chain B, Actinorhodin Polyketide Ketoreductase Mutant P94l Bound To Nadph And The Inhibitor Emodin Length = 281 Back     alignment and structure
>pdb|3AI3|A Chain A, The Crystal Structure Of L-Sorbose Reductase From Gluconobacter Frateurii Complexed With Nadph And L-Sorbose Length = 263 Back     alignment and structure
>pdb|1W4Z|A Chain A, Structure Of Actinorhodin Polyketide (Actiii) Reductase Length = 281 Back     alignment and structure
>pdb|2RH4|A Chain A, Actinorhodin Ketoreductase, Actkr, With Nadph And Inhibitor Emodin Length = 277 Back     alignment and structure
>pdb|1X7G|A Chain A, Actinorhodin Polyketide Ketoreductase, Act Kr, With Nadp Bound Length = 261 Back     alignment and structure
>pdb|3LYL|A Chain A, Structure Of 3-Oxoacyl-Acylcarrier Protein Reductase, Fabg From Francisella Tularensis Length = 247 Back     alignment and structure
>pdb|4DBZ|A Chain A, Crystal Structure Of V151l Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|4DC1|A Chain A, Crystal Structure Of Y202f Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|1EDO|A Chain A, The X-Ray Structure Of Beta-Keto Acyl Carrier Protein Reductase From Brassica Napus Complexed With Nadp+ Length = 244 Back     alignment and structure
>pdb|2HSD|A Chain A, The Refined Three-Dimensional Structure Of 3alpha,20beta- Hydroxysteroid Dehydrogenase And Possible Roles Of The Residues Conserved In Short-Chain Dehydrogenases Length = 253 Back     alignment and structure
>pdb|3GRP|A Chain A, 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Bartonella Henselae Length = 266 Back     alignment and structure
>pdb|2PD6|A Chain A, Structure Of Human Hydroxysteroid Dehydrogenase Type 8, Hsd17b8 Length = 264 Back     alignment and structure
>pdb|3F9I|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase Rickettsia Prowazekii Length = 249 Back     alignment and structure
>pdb|2CFC|A Chain A, Structural Basis For Stereo Selectivity In The (R)- And (S)- Hydroxypropylethane Thiosulfonate Dehydrogenases Length = 250 Back     alignment and structure
>pdb|4DC0|A Chain A, Crystal Structure Of F189w Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|2D1Y|A Chain A, Crystal Structure Of Tt0321 From Thermus Thermophilus Hb8 Length = 256 Back     alignment and structure
>pdb|2C07|A Chain A, Oxoacyl-Acp Reductase Of Plasmodium Falciparum Length = 285 Back     alignment and structure
>pdb|3V2H|A Chain A, The Crystal Structure Of D-Beta-Hydroxybutyrate Dehydrogenase From Sinorhizobium Meliloti Length = 281 Back     alignment and structure
>pdb|2EW8|A Chain A, Crystal Structure Of The (s)-specific 1-phenylethanol Dehydrogenase Of The Denitrifying Bacterium Strain Ebn1 Length = 249 Back     alignment and structure
>pdb|1CYD|A Chain A, Carbonyl Reductase Complexed With Nadph And 2-Propanol Length = 244 Back     alignment and structure
>pdb|2Q2Q|A Chain A, Structure Of D-3-Hydroxybutyrate Dehydrogenase From Pseudomonas Putida Length = 255 Back     alignment and structure
>pdb|4FN4|A Chain A, Short-chain Nad(h)-dependent Dehydrogenase/reductase From Sulfolobus Acidocaldarius Length = 254 Back     alignment and structure
>pdb|4DQX|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Rhizobium Etli Cfn 42 Length = 277 Back     alignment and structure
>pdb|3OIC|A Chain A, Crystal Structure Of Enoyl-Acp Reductases Iii (Fabl) From B. Subtilis (Apo Form) Length = 258 Back     alignment and structure
>pdb|1HDC|A Chain A, Mechanism Of Inhibition Of 3alpha,20beta-Hydroxysteroid Dehydrogenase By A Licorice-Derived Steroidal Inhibitor Length = 254 Back     alignment and structure
>pdb|2YZ7|A Chain A, X-Ray Analyses Of 3-Hydroxybutyrate Dehydrogenase From Alcaligenes Faecalis Length = 260 Back     alignment and structure
>pdb|3GK3|A Chain A, Crystal Structure Of Acetoacetyl-Coa Reductase From Burkholderia Pseudomallei 1710b Length = 269 Back     alignment and structure
>pdb|3GDF|A Chain A, Crystal Structure Of The Nadp-Dependent Mannitol Dehydrogenase From Cladosporium Herbarum. Length = 267 Back     alignment and structure
>pdb|1UZL|A Chain A, Maba From Mycobacterium Tuberculosis Length = 247 Back     alignment and structure
>pdb|4IIU|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Carrier Protein]reductase From Escherichia Coli Strain Cft073 Complexed With Nadp+ At 2.1 A Resolution Length = 267 Back     alignment and structure
>pdb|3VTZ|A Chain A, Structure Of Thermoplasma Volcanium Aldohexose Dehydrogenase Length = 269 Back     alignment and structure
>pdb|2NTN|A Chain A, Crystal Structure Of Maba-c60v/g139a/s144l Length = 267 Back     alignment and structure
>pdb|3AK4|A Chain A, Crystal Structure Of Nadh-Dependent Quinuclidinone Reductase From Agrobacterium Tumefaciens Length = 263 Back     alignment and structure
>pdb|2ZK7|A Chain A, Structure Of A C-Terminal Deletion Mutant Of Thermoplasma Acidophilum Aldohexose Dehydrogenase (Aldt) Length = 257 Back     alignment and structure
>pdb|1NFF|A Chain A, Crystal Structure Of Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 Back     alignment and structure
>pdb|2DTD|A Chain A, Structure Of Thermoplasma Acidophilum Aldohexose Dehydrogenase (aldt) In Ligand-free Form Length = 264 Back     alignment and structure
>pdb|1UZM|A Chain A, Maba From Mycobacterium Tuberculosis Length = 247 Back     alignment and structure
>pdb|3CTM|A Chain A, Crystal Structure Of A Carbonyl Reductase From Candida Parapsilosis With Anti-Prelog Stereo-Specificity Length = 279 Back     alignment and structure
>pdb|1NXQ|A Chain A, Crystal Structure Of R-Alcohol Dehydrogenase (Radh) (Apoenyzme) From Lactobacillus Brevis Length = 251 Back     alignment and structure
>pdb|3UN1|A Chain A, Crystal Structure Of An Oxidoreductase From Sinorhizobium Meliloti 1021 Length = 260 Back     alignment and structure
>pdb|4HP8|A Chain A, Crystal Structure Of A Putative 2-Deoxy-D-Gluconate 3-Dehydrogenase From Agrobacterium Tumefaciens (Target Efi-506435) With Bound Nadp Length = 247 Back     alignment and structure
>pdb|3TZQ|B Chain B, Crystal Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Marinum Length = 271 Back     alignment and structure
>pdb|3N74|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reduc Brucella Melitensis Length = 261 Back     alignment and structure
>pdb|1ZJY|A Chain A, Structure Of R-Specific Alcohol Dehydrogenase (Mutant G37d) From Lactobacillus Brevis In Complex With Phenylethanol And Nadh Length = 251 Back     alignment and structure
>pdb|1H5Q|A Chain A, Mannitol Dehydrogenase From Agaricus Bisporus Length = 265 Back     alignment and structure
>pdb|3OEC|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Thermoresistibile Length = 317 Back     alignment and structure
>pdb|1O5I|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Reductase (Tm1169) From Thermotoga Maritima At 2.50 A Resolution Length = 249 Back     alignment and structure
>pdb|3RIH|A Chain A, Crystal Structure Of A Putative Short Chain Dehydrogenase Or Reductase From Mycobacterium Abscessus Length = 293 Back     alignment and structure
>pdb|1PR9|A Chain A, Human L-Xylulose Reductase Holoenzyme Length = 244 Back     alignment and structure
>pdb|1ZEM|A Chain A, Crystal Structure Of Nad+-Bound Xylitol Dehydrogenase Length = 262 Back     alignment and structure
>pdb|1NFR|A Chain A, Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 Back     alignment and structure
>pdb|1FJH|A Chain A, The Crystal Structure Of 3-Alpha-Hydroxysteroid Dehydrogenase From Comamonas Testosteroni, A Member Of The Short Chain DehydrogenaseREDUCTASE FAMILY Length = 257 Back     alignment and structure
>pdb|1ULS|A Chain A, Crystal Structure Of Tt0140 From Thermus Thermophilus Hb8 Length = 245 Back     alignment and structure
>pdb|1WMB|A Chain A, Crystal Structure Of Nad Dependent D-3-Hydroxybutylate Dehydrogenase Length = 260 Back     alignment and structure
>pdb|3U0B|A Chain A, Crystal Structure Of An Oxidoreductase From Mycobacterium Smegmatis Length = 454 Back     alignment and structure
>pdb|1SPX|A Chain A, Crystal Structure Of Glucose Dehydrogenase Of Caenorhabditis Elegans In The Apo-Form Length = 278 Back     alignment and structure
>pdb|1K2W|A Chain A, Crystal Structure Of Sorbitol Dehydrogenase From R. Sphaeroides Length = 256 Back     alignment and structure
>pdb|2CF2|E Chain E, Architecture Of Mammalian Fatty Acid Synthase Length = 226 Back     alignment and structure
>pdb|2ZTM|A Chain A, T190s Mutant Of D-3-Hydroxybutyrate Dehydrogenase Length = 260 Back     alignment and structure
>pdb|2ZTU|A Chain A, T190a Mutant Of D-3-Hydroxybutyrate Dehydrogenase Complexed With Nad+ Length = 260 Back     alignment and structure
>pdb|3D3W|A Chain A, Structure Of L-Xylulose Reductase With Bound Coenzyme, Phosphate And Hydroxide Length = 244 Back     alignment and structure
>pdb|3I4F|A Chain A, Structure Of Putative 3-oxoacyl-reductase From Bacillus Thuringiensis Length = 264 Back     alignment and structure
>pdb|4EGF|A Chain A, Crystal Structure Of A L-Xylulose Reductase From Mycobacterium Smegmatis Length = 266 Back     alignment and structure
>pdb|3EZL|A Chain A, Crystal Structure Of Acetyacetyl-Coa Reductase From Burkholderia Pseudomallei 1710b Length = 256 Back     alignment and structure
>pdb|2A4K|A Chain A, 3-Oxoacyl-[acyl Carrier Protein] Reductase From Thermus Thermophilus Tt0137 Length = 263 Back     alignment and structure
>pdb|4IMR|A Chain A, Crystal Structure Of 3-oxoacyl (acyl-carrier-protein) Reductase (target Efi-506442) From Agrobacterium Tumefaciens C58 With Nadp Bound Length = 275 Back     alignment and structure
>pdb|4E3Z|A Chain A, Crystal Structure Of A Oxidoreductase From Rhizobium Etli Cfn 42 Length = 272 Back     alignment and structure
>pdb|1XHL|A Chain A, Crystal Structure Of Putative Tropinone Reductase-Ii From Caenorhabditis Elegans With Cofactor And Substrate Length = 297 Back     alignment and structure
>pdb|3IMF|A Chain A, 1.99 Angstrom Resolution Crystal Structure Of A Short Chain Dehydrogenase From Bacillus Anthracis Str. 'ames Ancestor' Length = 257 Back     alignment and structure
>pdb|3SJU|A Chain A, Hedamycin Polyketide Ketoreductase Bound To Nadph Length = 279 Back     alignment and structure
>pdb|4FGS|A Chain A, Crystal Structure Of A Probable Dehydrogenase Protein Length = 273 Back     alignment and structure
>pdb|3UXY|A Chain A, The Crystal Structure Of Short Chain Dehydrogenase From Rhodobacter Sphaeroides Length = 266 Back     alignment and structure
>pdb|2BGK|A Chain A, X-Ray Structure Of Apo-Secoisolariciresinol Dehydrogenase Length = 278 Back     alignment and structure
>pdb|3SVT|A Chain A, Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Ulcerans Length = 281 Back     alignment and structure
>pdb|3NUG|A Chain A, Crystal Structure Of Wild Type Tetrameric Pyridoxal 4-Dehydrogenase From Mesorhizobium Loti Length = 247 Back     alignment and structure
>pdb|4ESO|A Chain A, Crystal Structure Of A Putative Oxidoreductase Protein From Sinorhizobium Meliloti 1021 In Complex With Nadp Length = 255 Back     alignment and structure
>pdb|3VC7|A Chain A, Crystal Structure Of A Putative Oxidoreductase From Sinorhizobium Meliloti 1021 Length = 254 Back     alignment and structure
>pdb|2DKN|A Chain A, Crystal Structure Of The 3-alpha-hydroxysteroid Dehydrogenase From Pseudomonas Sp. B-0831 Complexed With Nadh Length = 255 Back     alignment and structure
>pdb|4GKB|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase Homolog (Target Efi- 505321) From Burkholderia Multivorans, Unliganded Structure Length = 258 Back     alignment and structure
>pdb|1HXH|A Chain A, Comamonas Testosteroni 3beta17BETA HYDROXYSTEROID Dehydrogenase Length = 253 Back     alignment and structure
>pdb|1YBV|A Chain A, Structure Of Trihydroxynaphthalene Reductase In Complex With Nadph And An Active Site Inhibitor Length = 283 Back     alignment and structure
>pdb|1DOH|A Chain A, Structure Of Trihydroxynaphthalene Reductase In Complex With Nadph And 4-nitro-inden-1-one Length = 283 Back     alignment and structure
>pdb|3V2G|A Chain A, Crystal Structure Of A DehydrogenaseREDUCTASE FROM SINORHIZOBIUM Meliloti 1021 Length = 271 Back     alignment and structure
>pdb|3PGX|A Chain A, Crystal Structure Of A Putative Carveol Dehydrogenase From Mycobacterium Paratuberculosis Bound To Nicotinamide Adenine Dinucleotide Length = 280 Back     alignment and structure
>pdb|3O38|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Mycobacterium Smegmatis Length = 266 Back     alignment and structure
>pdb|1XKQ|A Chain A, Crystal Structure Of Short-Chain DehydrogenaseREDUCTASE OF Unknown Function From Caenorhabditis Elegans With Cofactor Length = 280 Back     alignment and structure
>pdb|3TOX|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase In Complex With Nad(P) From Sinorhizobium Meliloti 1021 Length = 280 Back     alignment and structure
>pdb|3NDR|A Chain A, Crystal Structure Of Tetrameric Pyridoxal 4-Dehydrogenase From Mesorhizobium Loti Length = 247 Back     alignment and structure
>pdb|3V8B|A Chain A, Crystal Structure Of A 3-Ketoacyl-Acp Reductase From Sinorhizobium Meliloti 1021 Length = 283 Back     alignment and structure
>pdb|3ICC|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-(Acyl Carrier Protein) Reductase From Bacillus Anthracis At 1.87 A Resolution Length = 255 Back     alignment and structure
>pdb|4IQG|C Chain C, Crystal Structure Of Bpro0239 Oxidoreductase From Polaromonas Sp. Js666 In Nadp Bound Form Length = 271 Back     alignment and structure
>pdb|3GVC|A Chain A, Crystal Structure Of Probable Short-Chain Dehydrogenase- Reductase From Mycobacterium Tuberculosis Length = 277 Back     alignment and structure
>pdb|4FC6|A Chain A, Studies On Dcr Shed New Light On Peroxisomal Beta-Oxidation: Crystal Structure Of The Ternary Complex Of Pdcr Length = 277 Back     alignment and structure
>pdb|3GED|A Chain A, Fingerprint And Structural Analysis Of A Apo Scor Enzyme From Clostridium Thermocellum Length = 247 Back     alignment and structure
>pdb|3R3S|A Chain A, Structure Of The Ygha Oxidoreductase From Salmonella Enterica Length = 294 Back     alignment and structure
>pdb|2AG5|A Chain A, Crystal Structure Of Human Dhrs6 Length = 246 Back     alignment and structure
>pdb|4IXT|A Chain A, Structure Of A 37-fold Mutant Of Halohydrin Dehalogenase (hhec) Bound To Ethyl (r)-4-cyano-3-hydroxybutyrate Length = 254 Back     alignment and structure
>pdb|3EDM|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Agrobacterium Tumefaciens Length = 259 Back     alignment and structure
>pdb|2FWM|X Chain X, Crystal Structure Of E. Coli Enta, A 2,3-Dihydrodihydroxy Benzoate Dehydrogenase Length = 250 Back     alignment and structure
>pdb|3Q6I|A Chain A, Crystal Structure Of Fabg4 And Coenzyme Binary Complex Length = 446 Back     alignment and structure
>pdb|1P33|A Chain A, Pteridine Reductase From Leishmania Tarentolae Complex With Nadph And Mtx Length = 289 Back     alignment and structure
>pdb|4FW8|A Chain A, Crystal Structure Of Fabg4 Complexed With Coenzyme Nadh Length = 454 Back     alignment and structure
>pdb|3A28|C Chain C, Crystal Structure Of L-2,3-Butanediol Dehydrogenase Length = 258 Back     alignment and structure
>pdb|3V1T|C Chain C, Crystal Structure Of A Putative Ketoacyl Reductase (Fabg4) From Mycobacterium Tuberculosis H37rv At 1.9 Angstrom Resolution Length = 462 Back     alignment and structure
>pdb|3M1L|A Chain A, Crystal Strucutre Of A C-Terminal Trunacted Mutant Of A Putative Ketoacyl Reductase (Fabg4) From Mycobacterium Tuberculosis H37rv At 2.5 Angstrom Resolution Length = 432 Back     alignment and structure
>pdb|3LLS|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Mycobacterium Tuberculosis Length = 475 Back     alignment and structure
>pdb|3QIV|A Chain A, Crystal Structure Of A Putative Short-Chain Dehydrogenase Or 3- Oxoacyl-[acyl-Carrier-Protein] Reductase From Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 253 Back     alignment and structure
>pdb|3OML|A Chain A, Structure Of Full-Length Peroxisomal Multifunctional Enzyme Type 2 From Drosophila Melanogaster Length = 613 Back     alignment and structure
>pdb|3U5T|A Chain A, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Sinorhizobium Meliloti Length = 267 Back     alignment and structure
>pdb|3SX2|A Chain A, Crystal Structure Of A Putative 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Mycobacterium Paratuberculosis In Complex With Nad Length = 278 Back     alignment and structure
>pdb|3TSC|A Chain A, Crystal Structure Of Short Chain Dehydrogenase Map_2410 From Mycobacterium Paratuberculosis Bound To Nad Length = 277 Back     alignment and structure
>pdb|3UVE|A Chain A, Crystal Structure Of Carveol Dehydrogenase ((+)-Trans-Carveol Dehydrogenase) From Mycobacterium Avium Length = 286 Back     alignment and structure
>pdb|3OIF|A Chain A, Crystal Structure Of Enoyl-Acp Reductases I (Fabi) From B. Subtilis (Complex With Nad And Tcl) Length = 266 Back     alignment and structure
>pdb|1PWX|A Chain A, Crystal Structure Of The Haloalcohol Dehalogenase Hhec Complexed With Bromide Length = 254 Back     alignment and structure
>pdb|1W6U|A Chain A, Structure Of Human Decr Ternary Complex Length = 302 Back     alignment and structure
>pdb|1BDB|A Chain A, Cis-Biphenyl-2,3-Dihydrodiol-2,3-Dehydrogenase From Pseudomonas Sp. Lb400 Length = 277 Back     alignment and structure
>pdb|2Y93|A Chain A, Crystal Structure Of Cis-Biphenyl-2,3-Dihydrodiol-2,3- Dehydrogenase (Bphb)from Pandoraea Pnomenusa Strain B-356. Length = 281 Back     alignment and structure
>pdb|4E4Y|A Chain A, The Crystal Structure Of A Short Chain Dehydrogenase Family Protein From Francisella Tularensis Subsp. Tularensis Schu S4 Length = 244 Back     alignment and structure
>pdb|3RKR|A Chain A, Crystal Structure Of A Metagenomic Short-Chain Oxidoreductase (Sdr) In Complex With Nadp Length = 262 Back     alignment and structure
>pdb|1YDE|A Chain A, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3 Length = 270 Back     alignment and structure
>pdb|2XOX|A Chain A, Crystal Structure Of Pteridine Reductase (Ptr1) From Leishmania Donovani Length = 288 Back     alignment and structure
>pdb|3T7C|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Avium Bound To Nad Length = 299 Back     alignment and structure
>pdb|2Z1N|A Chain A, Crystal Structure Of Ape0912 From Aeropyrum Pernix K1 Length = 260 Back     alignment and structure
>pdb|1GEG|A Chain A, Cryatal Structure Analysis Of Meso-2,3-Butanediol Dehydrogenase Length = 256 Back     alignment and structure
>pdb|1W73|A Chain A, Binary Structure Of Human Decr Solved By Semet Sad. Length = 302 Back     alignment and structure
>pdb|4FS3|A Chain A, Crystal Structure Of Staphylococcus Aureus Enoyl-Acp Reductase In Complex With Nadp And Afn-1252 Length = 256 Back     alignment and structure
>pdb|2ET6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candida Tropicalis Peroxisomal Multifunctional Enzyme Type 2 Length = 604 Back     alignment and structure
>pdb|3T4X|A Chain A, Short Chain DehydrogenaseREDUCTASE FAMILY OXIDOREDUCTASE FROM Bacillus Anthracis Str. Ames Ancestor Length = 267 Back     alignment and structure
>pdb|4ALL|A Chain A, Crystal Structure Of S. Aureus Fabi In Complex With Nadp And Triclosan (P212121) Length = 277 Back     alignment and structure
>pdb|2QQ5|A Chain A, Crystal Structure Of Human Sdr Family Member 1 Length = 260 Back     alignment and structure
>pdb|3GNT|A Chain A, Crystal Structure Of The Staphylococcus Aureus Enoyl-Acyl Carrier Protein Reductase (Fabi) In Apo Form (Two Molecules In Au) Length = 256 Back     alignment and structure
>pdb|4ALI|A Chain A, Crystal Structure Of S. Aureus Fabi In Complex With Nadp And Triclosan (P1) Length = 282 Back     alignment and structure
>pdb|3GNS|A Chain A, Crystal Structure Of The Staphylococcus Aureus Enoyl-Acyl Carrier Protein Reductase (Fabi) In Apo Form (One Molecule In Au) Length = 260 Back     alignment and structure
>pdb|3IS3|A Chain A, Crystal Structure Of 17beta-Hydroxysteroid Dehydrogenase (Apo Form) From Fungus Cochliobolus Lunatus Length = 270 Back     alignment and structure
>pdb|3S55|A Chain A, Crystal Structure Of A Putative Short-Chain DehydrogenaseREDUCTASE From Mycobacterium Abscessus Bound To Nad Length = 281 Back     alignment and structure
>pdb|1ZMO|A Chain A, Apo Structure Of Haloalcohol Dehalogenase Hhea Of Arthrobacter Sp. Ad2 Length = 244 Back     alignment and structure
>pdb|3ITD|A Chain A, Crystal Structure Of An Inactive 17beta-Hydroxysteroid Dehydrogenase (Y167f Mutated Form) From Fungus Cochliobolus Lunatus Length = 270 Back     alignment and structure
>pdb|4E6P|A Chain A, Crystal Structure Of A Probable Sorbitol Dehydrogenase (Target Psi- 012078) From Sinorhizobium Meliloti 1021 Length = 259 Back     alignment and structure
>pdb|1E7W|A Chain A, One Active Site, Two Modes Of Reduction Correlate The Mechanism Of Leishmania Pteridine Reductase With Pterin Metabolism And Antifolate Drug Resistance In Trpanosomes Length = 291 Back     alignment and structure
>pdb|3RKU|A Chain A, Substrate Fingerprint And The Structure Of Nadp+ Dependent Serine Dehydrogenase From Saccharomyces Cerevisiae Complexed With Nadp+ Length = 287 Back     alignment and structure
>pdb|1E92|A Chain A, Pteridine Reductase 1 From Leishmania Major Complexed With Nadp+ And Dihydrobiopterin Length = 288 Back     alignment and structure
>pdb|2QHX|A Chain A, Structure Of Pteridine Reductase From Leishmania Major Complexed With A Ligand Length = 328 Back     alignment and structure
>pdb|1W0C|A Chain A, Inhibition Of Leishmania Major Pteridine Reductase (Ptr1) By 2,4,6-Triaminoquinazoline; Structure Of The Nadp Ternary Complex. Length = 307 Back     alignment and structure
>pdb|1ZBQ|A Chain A, Crystal Structure Of Human 17-beta-hydroxysteroid Dehydrogenase Type 4 In Complex With Nad Length = 327 Back     alignment and structure
>pdb|3OJF|A Chain A, Crystal Structure Of The Bacillus Cereus Enoyl-Acyl Carrier Protein Reductase With Nadp+ And Indole Naphthyridinone (Complex Form) Length = 257 Back     alignment and structure
>pdb|2QIO|A Chain A, X-Ray Structure Of Enoyl-Acyl Carrier Protein Reductase From Bacillus Anthracis With Triclosan Length = 256 Back     alignment and structure
>pdb|2BD0|A Chain A, Chlorobium Tepidum Sepiapterin Reductase Complexed With Nadp And Sepiapterin Length = 244 Back     alignment and structure
>pdb|1MXF|A Chain A, Crystal Structure Of Inhibitor Complex Of Putative Pteridine Reductase 2 (Ptr2) From Trypanosoma Cruzi Length = 276 Back     alignment and structure
>pdb|1JA9|A Chain A, Crystal Structure Of 1,3,6,8-Tetrahydroxynaphthalene Reductase In Complex With Nadph And Pyroquilon Length = 274 Back     alignment and structure
>pdb|3AFM|A Chain A, Crystal Structure Of Aldose Reductase A1-R Responsible For Alginate Metabolism Length = 258 Back     alignment and structure
>pdb|1MXH|A Chain A, Crystal Structure Of Substrate Complex Of Putative Pteridine Reductase 2 (Ptr2) From Trypanosoma Cruzi Length = 276 Back     alignment and structure
>pdb|1E6W|A Chain A, Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Complex With Nadh And Estradiol Length = 260 Back     alignment and structure
>pdb|1E3S|A Chain A, Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Complex With Nadh Length = 261 Back     alignment and structure
>pdb|4DA9|A Chain A, Crystal Structure Of Putative Short-Chain DehydrogenaseREDUCTASE FROM Sinorhizobium Meliloti 1021 Length = 280 Back     alignment and structure
>pdb|3ASU|A Chain A, Crystal Structure Of Serine Dehydrogenase From Escherichia Coli Length = 248 Back     alignment and structure
>pdb|4H15|A Chain A, Crystal Structure Of A Short Chain Alcohol Dehydrogenase-Related Dehydrogenase (Target Id Nysgrc-011812) From Sinorhizobium Meliloti 1021 In Space Group P21 Length = 261 Back     alignment and structure
>pdb|3KSU|A Chain A, Crystal Structure Of Short-Chain Dehydrogenase From Oenococcus Oeni Psu-1 Length = 262 Back     alignment and structure
>pdb|4BB5|A Chain A, Free-Wilson And Structural Approaches To Co-Optimising Human And Rodent Isoform Potency For 11b-Hydroxysteroid Dehydrogenase Type 1 11b-Hsd1 Inhibitors Length = 292 Back     alignment and structure
>pdb|4BB6|A Chain A, Free-Wilson And Structural Approaches To Co-Optimising Human And Rodent Isoform Potency For 11b-Hydroxysteroid Dehydrogenase Type 1 11b-Hsd1 Inhibitors Length = 292 Back     alignment and structure
>pdb|1ULU|A Chain A, Crystal Structure Of Tt0143 From Thermus Thermophilus Hb8 Length = 261 Back     alignment and structure
>pdb|3UWR|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Avium Strain 104 Length = 286 Back     alignment and structure
>pdb|4HFR|A Chain A, Human 11beta-Hydroxysteroid Dehydrogenase Type 1 In Complex With An Orally Bioavailable Acidic Inhibitor Azd4017. Length = 272 Back     alignment and structure
>pdb|2YW9|A Chain A, Crystal Structure Of Tt0143 From Thermus Thermophilus Hb8 Length = 261 Back     alignment and structure
>pdb|1E3W|A Chain A, Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Complex With Nadh And 3-Keto Butyrate Length = 261 Back     alignment and structure
>pdb|1XU7|A Chain A, Crystal Structure Of The Interface Open Conformation Of Tetrameric 11b-hsd1 Length = 286 Back     alignment and structure
>pdb|2RBE|A Chain A, The Discovery Of 2-Anilinothiazolones As 11beta-Hsd1 Inhibitors Length = 275 Back     alignment and structure
>pdb|2ILT|A Chain A, Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) With Nadp And Adamantane Sulfone Inhibitor Length = 275 Back     alignment and structure
>pdb|3PDJ|A Chain A, Crystal Structure Of Human 11-Beta-Hydroxysteroid Dehydrogenase 1 (11b-Hsd1) In Complex With 4,4-Disubstituted Cyclohexylbenzamide Inhibitor Length = 273 Back     alignment and structure
>pdb|3D5Q|A Chain A, Crystal Structure Of 11b-Hsd1 In Complex With Triazole Inhibitor Length = 272 Back     alignment and structure
>pdb|2IRW|A Chain A, Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) With Nadp And Adamantane Ether Inhibitor Length = 264 Back     alignment and structure
>pdb|2BEL|A Chain A, Structure Of Human 11-Beta-Hydroxysteroid Dehydrogenase In Complex With Nadp And Carbenoxolone Length = 283 Back     alignment and structure
>pdb|1CWU|A Chain A, Brassica Napus Enoyl Acp Reductase A138g Mutant Complexed With Nad+ And Thienodiazaborine Length = 296 Back     alignment and structure
>pdb|3CH6|A Chain A, Crystal Structure Of 11beta-Hsd1 Double Mutant (L262r, F278e) Complexed With (3,3-Dimethylpiperidin-1-Yl)(6-(3- Fluoro-4-Methylphenyl)pyridin-2-Yl)methanone Length = 286 Back     alignment and structure
>pdb|2NWQ|A Chain A, Short Chain Dehydrogenase From Pseudomonas Aeruginosa Length = 272 Back     alignment and structure
>pdb|3PPI|A Chain A, Crystal Structure Of 3-Hydroxyacyl-Coa Dehydrogenase Type-2 From Mycobacterium Avium Length = 281 Back     alignment and structure
>pdb|3TJR|A Chain A, Crystal Structure Of A Rv0851c Ortholog Short Chain Dehydrogenase From Mycobacterium Paratuberculosis Length = 301 Back     alignment and structure
>pdb|3UCX|A Chain A, The Structure Of A Short Chain Dehydrogenase From Mycobacterium Smegmatis Length = 264 Back     alignment and structure
>pdb|3LZ6|A Chain A, Guinea Pig 11beta Hydroxysteroid Dehydrogenase With Pf-877423 Length = 263 Back     alignment and structure
>pdb|1XSE|A Chain A, Crystal Structure Of Guinea Pig 11beta-Hydroxysteroid Dehydrogenase Type 1 Length = 295 Back     alignment and structure
>pdb|3G49|A Chain A, N-(Pyridin-2-Yl) Arylsulfonamide Inhibitors Of 11b-Hydroxysteroid Dehydrogenase Type 1: Discovery Of Pf-915275 Length = 277 Back     alignment and structure
>pdb|3DWF|A Chain A, Crystal Structure Of The Guinea Pig 11beta-Hydroxysteroid Dehydrogenase Type 1 Mutant F278e Length = 276 Back     alignment and structure
>pdb|1GZ6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat Peroxisomal Multifunctional Enzyme Type 2 Length = 319 Back     alignment and structure
>pdb|2GDZ|A Chain A, Crystal Structure Of 15-Hydroxyprostaglandin Dehydrogenase Type1, Complexed With Nad+ Length = 267 Back     alignment and structure
>pdb|2JAP|A Chain A, Clavulanic Acid Dehydrogenase: Structural And Biochemical Analysis Of The Final Step In The Biosynthesis Of The Beta- Lactamase Inhibitor Clavulanic Acid Length = 247 Back     alignment and structure
>pdb|1ENO|A Chain A, Brassica Napus Enoyl Acp ReductaseNAD BINARY COMPLEX AT PH 8.0 AND Room Temperature Length = 312 Back     alignment and structure
>pdb|3LF1|A Chain A, Apo Structure Of The Short Chain Oxidoreductase Q9hya2 From Pseudomonas Aeruginosa Pao1 Containing An Atypical Catalytic Center Length = 265 Back     alignment and structure
>pdb|1D7O|A Chain A, Crystal Structure Of Brassica Napus Enoyl Acyl Carrier Protein Reductase Complexed With Nad And Triclosan Length = 297 Back     alignment and structure
>pdb|2EHD|A Chain A, Crystal Structure Analysis Of Oxidoreductase Length = 234 Back     alignment and structure
>pdb|3M1A|A Chain A, The Crystal Structure Of A Short-Chain Dehydrogenase From Streptomyces Avermitilis To 2a Length = 281 Back     alignment and structure
>pdb|2P91|A Chain A, Crystal Structure Of Enoyl-[acyl-Carrier-Protein] Reductase (Nadh) From Aquifex Aeolicus Vf5 Length = 285 Back     alignment and structure
>pdb|1U7T|A Chain A, Crystal Structure Of AbadHSD10 WITH A BOUND INHIBITOR Length = 261 Back     alignment and structure
>pdb|1SO8|A Chain A, Abeta-bound Human Abad Structure [also Known As 3-hydroxyacyl-coa Dehydrogenase Type Ii (type Ii Hadh), Endoplasmic Reticulum- Associated Amyloid Beta-peptide Binding Protein (erab)] Length = 261 Back     alignment and structure
>pdb|2O23|A Chain A, The Structure Of Wild-Type Human Hadh2 (17beta-Hydroxysteroid Dehydrogenase Type 10) Bound To Nad+ At 1.2 A Length = 265 Back     alignment and structure
>pdb|3UCE|A Chain A, Crystal Structure Of A Small-Chain Dehydrogenase In Complex With Nadph Length = 223 Back     alignment and structure
>pdb|1YB1|A Chain A, Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type Xi Length = 272 Back     alignment and structure
>pdb|3JQ7|A Chain A, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Ternary Complex With Cofactor (Nadp+) And Inhibitor 6- Phenylpteridine-2,4,7-Triamine (Dx2) Length = 288 Back     alignment and structure
>pdb|3JQ7|B Chain B, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Ternary Complex With Cofactor (Nadp+) And Inhibitor 6- Phenylpteridine-2,4,7-Triamine (Dx2) Length = 288 Back     alignment and structure
>pdb|3BMC|A Chain A, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Ternary Complex With Cofactor (Nadp+) And Substrate (Folate) Length = 288 Back     alignment and structure
>pdb|2C7V|A Chain A, Structure Of Trypanosoma Brucei Pteridine Reductase (Ptr1) In Ternary Complex With Cofactor And The Antifolate Methotrexate Length = 268 Back     alignment and structure
>pdb|3BMC|B Chain B, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Ternary Complex With Cofactor (Nadp+) And Substrate (Folate) Length = 288 Back     alignment and structure
>pdb|2WD7|B Chain B, Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Complex With Nadp And Ddd00066750 Length = 268 Back     alignment and structure
>pdb|2WD7|A Chain A, Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Complex With Nadp And Ddd00066750 Length = 268 Back     alignment and structure
>pdb|2JAH|A Chain A, Biochemical And Structural Analysis Of The Clavulanic Acid Dehydeogenase (Cad) From Streptomyces Clavuligerus Length = 247 Back     alignment and structure
>pdb|1Y5M|A Chain A, The Crystal Structure Of Murine 11b-Hydroxysteroid Dehydrogenase: An Important Therapeutic Target For Diabetes Length = 276 Back     alignment and structure
>pdb|3EK2|A Chain A, Crystal Structure Of Eonyl-(Acyl Carrier Protein) Reductase From Burkholderia Pseudomallei 1719b Length = 271 Back     alignment and structure
>pdb|3GMD|A Chain A, Structure-Based Design Of 7-Azaindole-Pyrrolidines As Inhibitors Of 11beta-Hydroxysteroid-Dehydrogenase Type I Length = 264 Back     alignment and structure
>pdb|2JJY|A Chain A, Crystal Structure Of Francisella Tularensis Enoyl Reductase (Ftfabi) With Bound Nad Length = 268 Back     alignment and structure
>pdb|3NRC|A Chain A, Crystal Stucture Of The Francisella Tularensis Enoyl-Acyl Carrier Protein Reductase (Fabi) In Complex With Nad+ And Triclosan Length = 280 Back     alignment and structure
>pdb|3QLJ|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Mycobacterium Avium Length = 322 Back     alignment and structure
>pdb|3E9N|A Chain A, Crystal Structure Of A Putative Short-Chain DehydrogenaseREDUCTASE FROM CORYNEBACTERIUM GLUTAMICUM Length = 245 Back     alignment and structure
>pdb|1QSG|A Chain A, Crystal Structure Of Enoyl Reductase Inhibition By Triclosan Length = 265 Back     alignment and structure
>pdb|3PJD|A Chain A, Structure Of Enr G93a Mutant-Nad+-Triclosan Complex Length = 270 Back     alignment and structure
>pdb|3PJF|A Chain A, Structure Of Enr G93v Mutant-Nad+-Triclosan Complex Length = 270 Back     alignment and structure
>pdb|1DFG|A Chain A, X-Ray Structure Of Escherichia Coli Enoyl Reductase With Bound Nad And Benzo-Diazaborine Length = 261 Back     alignment and structure
>pdb|1C14|A Chain A, Crystal Structure Of E Coli Enoyl Reductase-nad+-triclosan Complex Length = 262 Back     alignment and structure
>pdb|3PJE|A Chain A, Structure Of Enr G93s Mutant-Nad+-Triclosan Complex Length = 270 Back     alignment and structure
>pdb|4EIT|A Chain A, Crystal Structure Of An Enoyl-(Acyl Carrier Protein) Reductase From Bartonella Henselae Length = 276 Back     alignment and structure
>pdb|3I1J|A Chain A, Structure Of A Putative Short Chain Dehydrogenase From Pseudomonas Syringae Length = 247 Back     alignment and structure
>pdb|3GRK|A Chain A, Crystal Structure Of Short Chain Dehydrogenase Reductase Sdr Glucose-Ribitol Dehydrogenase From Brucella Melitensis Length = 293 Back     alignment and structure
>pdb|3G1T|A Chain A, Crystal Structure Of Short Chain Dehydrogenase From Salmonella Enterica Subsp. Enterica Serovar Typhi Str. Ct18 Length = 258 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
1xq1_A266 Putative tropinone reducatse; structural genomics, 1e-129
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 1e-126
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 1e-125
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 1e-75
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 2e-72
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 3e-72
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 3e-71
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 6e-71
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 2e-70
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 3e-70
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 1e-69
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 2e-69
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 9e-69
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 3e-68
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 2e-67
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 6e-67
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 1e-66
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 1e-65
1spx_A278 Short-chain reductase family member (5L265); paral 3e-64
1xhl_A297 Short-chain dehydrogenase/reductase family member 5e-64
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 6e-64
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 6e-64
3cxt_A291 Dehydrogenase with different specificities; rossma 3e-63
1xkq_A280 Short-chain reductase family member (5D234); parra 3e-63
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 2e-62
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 4e-62
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 5e-62
4e4y_A244 Short chain dehydrogenase family protein; structur 9e-62
3imf_A257 Short chain dehydrogenase; structural genomics, in 2e-61
3tox_A280 Short chain dehydrogenase; structural genomics, PS 2e-61
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 2e-61
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 2e-61
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 7e-61
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 7e-61
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 9e-61
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 1e-60
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 3e-60
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 3e-60
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 4e-60
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 4e-60
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 6e-60
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 9e-60
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 1e-59
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 1e-59
4dqx_A277 Probable oxidoreductase protein; structural genomi 1e-59
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 3e-59
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 4e-59
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 4e-59
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 5e-59
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 7e-59
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 7e-59
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 2e-58
4eso_A255 Putative oxidoreductase; NADP, structural genomics 2e-58
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 3e-58
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 4e-58
3edm_A259 Short chain dehydrogenase; structural genomics, ox 5e-58
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 7e-58
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 7e-58
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 7e-58
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 9e-58
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 1e-57
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 3e-57
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 1e-56
3gem_A260 Short chain dehydrogenase; structural genomics, AP 2e-56
1nff_A260 Putative oxidoreductase RV2002; directed evolution 3e-56
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 6e-56
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 8e-56
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 1e-55
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 1e-55
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 2e-55
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 2e-55
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 8e-55
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 9e-55
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 1e-54
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 1e-54
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 2e-54
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 2e-54
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 3e-54
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 4e-54
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 8e-54
3rih_A293 Short chain dehydrogenase or reductase; structural 1e-53
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 1e-53
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 1e-53
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 1e-53
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 2e-53
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 3e-53
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 6e-53
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 3e-52
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 7e-52
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 8e-52
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 1e-51
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 1e-51
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 2e-51
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 2e-51
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 2e-51
3tsc_A277 Putative oxidoreductase; structural genomics, seat 4e-51
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 5e-51
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 6e-51
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 8e-51
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 3e-50
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 6e-50
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 1e-49
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 1e-49
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 1e-49
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 1e-49
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 2e-49
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 2e-49
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 3e-49
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 3e-49
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 4e-49
3e03_A274 Short chain dehydrogenase; structural genomics, PS 4e-49
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 5e-49
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 7e-49
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 8e-49
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 8e-49
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 9e-49
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 9e-49
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-48
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 4e-48
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 1e-47
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 2e-47
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 2e-47
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 3e-47
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 3e-47
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 4e-47
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 4e-47
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 6e-47
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 6e-47
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 9e-47
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 3e-46
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 6e-46
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 8e-46
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 1e-45
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 1e-45
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 1e-45
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 5e-45
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 9e-45
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 1e-44
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 1e-44
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 1e-44
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 1e-44
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 5e-44
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 8e-44
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 5e-43
1ooe_A236 Dihydropteridine reductase; structural genomics, P 7e-43
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 1e-42
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 1e-41
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 3e-41
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 1e-36
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 5e-36
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 1e-35
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 8e-35
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 2e-34
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 4e-34
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 2e-31
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 2e-31
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 3e-31
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 2e-30
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 7e-30
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 4e-29
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 4e-29
3qlj_A322 Short chain dehydrogenase; structural genomics, se 1e-28
3tjr_A301 Short chain dehydrogenase; structural genomics, se 2e-28
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 3e-27
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 7e-25
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 7e-26
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 4e-25
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 3e-23
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 4e-23
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 6e-22
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 4e-21
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 4e-21
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 3e-20
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 6e-20
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 1e-18
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 2e-18
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 6e-18
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 3e-17
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 6e-17
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 6e-17
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 4e-16
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 7e-15
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 8e-15
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 9e-15
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-14
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 2e-12
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 7e-12
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 1e-11
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 2e-11
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 2e-11
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 2e-11
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 2e-11
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 3e-11
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 3e-11
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 4e-11
4alk_A282 ENR, enoyl-[acyl-carrier-protein] reductase [NADPH 5e-11
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 1e-09
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 1e-09
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 2e-09
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 2e-08
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 6e-07
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
 Score =  364 bits (938), Expect = e-129
 Identities = 168/267 (62%), Positives = 200/267 (74%), Gaps = 24/267 (8%)

Query: 1   MAQAYDHDRQDRWSLQGMTALVTGGTKGLG-------------------NEAELNECLRE 41
           MA A   ++  RWSL+  T LVTGGTKG+G                   NE ELNECL +
Sbjct: 1   MAGA---EQSQRWSLKAKTVLVTGGTKGIGHAIVEEFAGFGAVIHTCARNEYELNECLSK 57

Query: 42  WKTKCFKVTGSVCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAEDL 101
           W+ K F+VTGSVCDAS R EREKLM+ VSS+F GKL+ILINN+G   + KPT++Y AED 
Sbjct: 58  WQKKGFQVTGSVCDASLRPEREKLMQTVSSMFGGKLDILINNLGAIRS-KPTLDYTAEDF 116

Query: 102 SFLMSTNFESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLAK 161
           SF +STN ESAYHLSQLAHPLLKASG GNII +SS+ GV+S ++G+IY+ATKGA+NQLA+
Sbjct: 117 SFHISTNLESAYHLSQLAHPLLKASGCGNIIFMSSIAGVVSASVGSIYSATKGALNQLAR 176

Query: 162 NLACEWARDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPGEPKEVSSLVAF 221
           NLACEWA D IR N+VAP  I TPL E  + D++F + V  R P+ R GEP+EVSSLVAF
Sbjct: 177 NLACEWASDGIRANAVAPAVIATPLAEA-VYDDEFKKVVISRKPLGRFGEPEEVSSLVAF 235

Query: 222 LCMPAASYITGQTICVDGGFTVNGFFF 248
           LCMPAASYITGQTICVDGG TVNGF +
Sbjct: 236 LCMPAASYITGQTICVDGGLTVNGFSY 262


>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Length = 258 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Length = 291 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Length = 294 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Length = 288 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} Length = 264 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Length = 247 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Length = 264 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Length = 285 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Length = 247 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Length = 246 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Length = 270 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Length = 269 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} PDB: 3sj7_A* Length = 246 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Length = 266 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 269 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Length = 248 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} Length = 256 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Length = 244 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} Length = 249 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Length = 245 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Length = 291 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Length = 328 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3q6i_A* 3m1l_A Length = 454 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Length = 257 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Length = 322 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 2jjy_A* Length = 280 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Length = 285 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Length = 261 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Length = 266 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} Length = 271 Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Length = 293 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Length = 296 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Length = 275 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Length = 265 Back     alignment and structure
>4alk_A ENR, enoyl-[acyl-carrier-protein] reductase [NADPH]; oxidoreductase, short-chain dehydrogenase/reductase superfam fatty acid biosynthesis; HET: NAP E9P GLU; 1.90A {Staphylococcus aureus} PDB: 4alj_A* 4ali_A* 4alm_A 4aln_A 3gr6_A* 3gns_A* 3gnt_A 4all_A* Length = 282 Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Length = 297 Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Length = 315 Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Length = 319 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Length = 269 Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Length = 329 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 100.0
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 100.0
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 100.0
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 100.0
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 100.0
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 100.0
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 100.0
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 100.0
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 100.0
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 100.0
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 100.0
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 100.0
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 100.0
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 100.0
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 100.0
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 100.0
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 100.0
3tox_A280 Short chain dehydrogenase; structural genomics, PS 100.0
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 100.0
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 100.0
3imf_A257 Short chain dehydrogenase; structural genomics, in 100.0
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 100.0
3rih_A293 Short chain dehydrogenase or reductase; structural 100.0
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 100.0
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 100.0
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 100.0
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 100.0
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 100.0
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 100.0
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 100.0
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 100.0
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 100.0
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 100.0
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 100.0
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 100.0
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 100.0
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
4dqx_A277 Probable oxidoreductase protein; structural genomi 100.0
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 100.0
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
4eso_A255 Putative oxidoreductase; NADP, structural genomics 100.0
3tsc_A277 Putative oxidoreductase; structural genomics, seat 100.0
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 100.0
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 100.0
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 100.0
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 100.0
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 100.0
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 100.0
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 100.0
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 100.0
3edm_A259 Short chain dehydrogenase; structural genomics, ox 100.0
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 100.0
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 100.0
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 100.0
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 100.0
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 100.0
3cxt_A291 Dehydrogenase with different specificities; rossma 100.0
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 100.0
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 100.0
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 100.0
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 100.0
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 100.0
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 100.0
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 100.0
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 100.0
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 100.0
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 100.0
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 100.0
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 100.0
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 100.0
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 100.0
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 100.0
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 100.0
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 100.0
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 100.0
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 100.0
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 100.0
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 100.0
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 100.0
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 100.0
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 100.0
3gem_A260 Short chain dehydrogenase; structural genomics, AP 100.0
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 100.0
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 100.0
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 100.0
1xhl_A297 Short-chain dehydrogenase/reductase family member 100.0
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 100.0
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 100.0
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 100.0
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 100.0
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 100.0
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 100.0
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 100.0
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 100.0
1xkq_A280 Short-chain reductase family member (5D234); parra 100.0
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 100.0
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 100.0
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 100.0
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 100.0
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 100.0
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 100.0
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 100.0
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 100.0
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 100.0
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 100.0
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 100.0
3e03_A274 Short chain dehydrogenase; structural genomics, PS 100.0
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 100.0
1xq1_A266 Putative tropinone reducatse; structural genomics, 100.0
4e4y_A244 Short chain dehydrogenase family protein; structur 100.0
1spx_A278 Short-chain reductase family member (5L265); paral 100.0
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 100.0
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 100.0
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 100.0
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 100.0
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 100.0
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 100.0
3qlj_A322 Short chain dehydrogenase; structural genomics, se 100.0
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 100.0
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 100.0
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 100.0
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 100.0
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 100.0
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 100.0
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 100.0
1nff_A260 Putative oxidoreductase RV2002; directed evolution 100.0
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 100.0
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 100.0
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 100.0
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 100.0
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 100.0
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 100.0
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 100.0
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 100.0
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 100.0
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 100.0
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 100.0
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 100.0
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 100.0
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 100.0
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 100.0
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 100.0
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 100.0
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 100.0
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 100.0
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 100.0
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 100.0
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 100.0
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 100.0
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 100.0
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 100.0
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 100.0
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 100.0
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 100.0
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 100.0
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 100.0
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 100.0
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 100.0
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 100.0
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 100.0
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 100.0
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 100.0
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 100.0
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 100.0
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 100.0
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 100.0
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 100.0
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 100.0
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 100.0
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 100.0
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 100.0
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 100.0
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 100.0
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 100.0
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 100.0
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 100.0
1ooe_A236 Dihydropteridine reductase; structural genomics, P 100.0
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 100.0
3tjr_A301 Short chain dehydrogenase; structural genomics, se 100.0
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 100.0
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 100.0
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 100.0
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 100.0
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 100.0
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 100.0
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 100.0
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 100.0
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 100.0
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 100.0
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 100.0
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 100.0
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 100.0
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 100.0
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 100.0
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 100.0
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 100.0
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 100.0
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 100.0
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 100.0
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 100.0
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 100.0
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 100.0
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 100.0
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 100.0
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.97
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.96
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.95
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.93
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.92
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.91
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.91
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.9
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.89
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.89
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.88
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.88
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.88
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.87
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.87
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.86
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.86
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.86
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.86
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.85
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.85
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.85
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.85
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.85
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.84
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.84
1xq6_A253 Unknown protein; structural genomics, protein stru 99.84
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.84
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.84
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.84
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.84
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.83
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.83
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.83
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.83
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.83
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.83
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.83
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.83
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.83
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.82
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.82
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.81
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.81
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.81
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.8
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.8
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.8
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.8
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.79
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.79
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.79
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.79
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.78
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.78
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.78
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.78
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.77
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.77
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.77
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.77
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.76
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.76
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.76
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.76
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.76
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.75
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.74
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.74
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.74
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.74
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.74
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.73
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.73
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.72
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.72
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.72
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.69
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.69
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 99.69
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.68
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.67
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.65
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.65
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.61
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.59
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.55
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 99.52
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.5
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.45
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 99.45
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.43
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.43
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.36
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.31
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.26
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.18
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.12
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 98.78
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 98.59
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 98.51
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 98.27
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 97.51
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 97.46
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.34
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 97.29
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.28
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 97.17
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 97.15
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 97.08
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 97.07
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 97.05
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 96.97
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 96.91
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 96.9
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 96.84
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 96.79
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 96.76
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 96.67
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 96.65
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 96.63
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 96.6
4eye_A342 Probable oxidoreductase; structural genomics, niai 96.58
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 96.57
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 96.5
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 96.49
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.34
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 96.31
3gms_A340 Putative NADPH:quinone reductase; structural genom 96.28
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.24
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 96.13
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 96.11
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 96.08
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 96.05
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 95.96
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 95.94
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 95.9
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 95.88
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 95.66
3fbg_A346 Putative arginate lyase; structural genomics, unkn 95.66
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 95.64
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 95.43
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 95.15
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 95.11
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 95.07
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 95.02
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 95.0
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 94.97
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 94.95
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 94.91
3krt_A456 Crotonyl COA reductase; structural genomics, prote 94.85
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 94.76
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 94.63
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 94.62
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 94.51
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 94.42
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.12
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 94.04
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 93.9
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 93.87
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 93.31
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 93.26
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 93.24
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 93.13
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 92.99
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 92.94
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 92.33
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 92.21
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 92.2
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 92.12
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 92.1
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 91.87
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 91.84
3mje_A 496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 91.71
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 91.62
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 91.48
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 91.3
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 91.27
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 91.21
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 91.19
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 91.18
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 91.17
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 91.11
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 91.1
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 90.85
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 90.8
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 90.72
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 90.71
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 90.33
3tl2_A315 Malate dehydrogenase; center for structural genomi 90.21
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 89.8
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 89.61
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 89.55
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 89.5
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 89.5
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 89.3
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 88.68
2fr1_A 486 Erythromycin synthase, eryai; short chain dehydrog 88.63
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 88.59
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 88.38
3p2o_A285 Bifunctional protein fold; structural genomics, ce 88.14
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 87.97
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 87.9
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 87.85
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 87.83
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 87.74
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 87.72
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 87.7
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 87.7
2rir_A300 Dipicolinate synthase, A chain; structural genomic 87.58
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 87.56
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 86.94
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 86.61
1lss_A140 TRK system potassium uptake protein TRKA homolog; 86.55
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 86.38
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 86.37
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 86.17
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 85.88
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 85.69
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 85.49
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 85.22
3c85_A183 Putative glutathione-regulated potassium-efflux S 85.19
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 85.14
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 84.89
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 84.79
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 84.38
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 84.33
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 83.95
3l07_A285 Bifunctional protein fold; structural genomics, ID 83.5
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 83.01
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 82.92
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 82.74
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 82.67
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 82.67
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 82.01
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 81.94
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 81.59
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 81.57
1id1_A153 Putative potassium channel protein; RCK domain, E. 81.44
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 80.92
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 80.54
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 80.48
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 80.22
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 80.11
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 80.08
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
Probab=100.00  E-value=6.8e-58  Score=369.48  Aligned_cols=230  Identities=26%  Similarity=0.413  Sum_probs=212.1

Q ss_pred             cCCCCCEEEEecCCCCcC-------------------cHHHHHHHHHHHHhcCCeeEEEeccCCCHHHHHHHHHHHHHhc
Q 041276           13 WSLQGMTALVTGGTKGLG-------------------NEAELNECLREWKTKCFKVTGSVCDASSRAEREKLMKQVSSLF   73 (251)
Q Consensus        13 ~~l~~k~vlItGas~giG-------------------~~~~~~~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~i~~~~   73 (251)
                      ++|+||++|||||++|||                   +++.++++.+++++.+.++.++.+|++|+++++++++++.++|
T Consensus         3 ~sL~gKvalVTGas~GIG~aiA~~la~~Ga~Vv~~~~~~~~~~~~~~~i~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~   82 (254)
T 4fn4_A            3 QSLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELLEDRLNQIVQELRGMGKEVLGVKADVSKKKDVEEFVRRTFETY   82 (254)
T ss_dssp             GGGTTCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHTTCCEEEEECCTTSHHHHHHHHHHHHHHH
T ss_pred             CCCCCCEEEEeCCCCHHHHHHHHHHHHcCCEEEEEECCHHHHHHHHHHHHhcCCcEEEEEccCCCHHHHHHHHHHHHHHc
Confidence            479999999999999999                   6788899999999989999999999999999999999999999


Q ss_pred             CCCccEEEEcccCCCCCCCCCCCCHHHHHHHHHhhhHHHHHHHHHHHHHHHhCCCceEEEecccccccCCCCChhhHHhH
Q 041276           74 NGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTNFESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATK  153 (251)
Q Consensus        74 ~~~id~lv~~ag~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~m~~~~~g~iv~vss~~~~~~~~~~~~Y~~sK  153 (251)
                       |+||+||||||+.....++.+.++++|++++++|+.++++++|+++|+|++++.|+||++||.++..+.+....|++||
T Consensus        83 -G~iDiLVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~g~~~~~~~~~Y~asK  161 (254)
T 4fn4_A           83 -SRIDVLCNNAGIMDGVTPVAEVSDELWERVLAVNLYSAFYSSRAVIPIMLKQGKGVIVNTASIAGIRGGFAGAPYTVAK  161 (254)
T ss_dssp             -SCCCEEEECCCCCCTTCCGGGCCHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTCEEEEEECCGGGTCSSSSCHHHHHHH
T ss_pred             -CCCCEEEECCcccCCCCChhhCCHHHHHHHHHHHhHHHHHHHHHHHHHHHHcCCcEEEEEechhhcCCCCCChHHHHHH
Confidence             8999999999987656789999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHccCCeEEEEEecCcccCCCCCCCCCC-HHHHHH-HhhCCCCCCCCCHHHHHHHHHHHcCCCCCCcc
Q 041276          154 GAMNQLAKNLACEWARDNIRINSVAPWFITTPLTEPYLSD-EKFLEE-VKCRTPMERPGEPKEVSSLVAFLCMPAASYIT  231 (251)
Q Consensus       154 ~a~~~~~~~la~e~~~~~i~v~~i~pG~v~t~~~~~~~~~-~~~~~~-~~~~~~~~~~~~~~dva~~~~~l~~~~~~~~~  231 (251)
                      +|+.+|+|++|.|++++|||||+|+||+++|||....... +..... .....|.+|+++|+|||++++||+|++++|+|
T Consensus       162 aal~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~R~g~pediA~~v~fLaSd~a~~iT  241 (254)
T 4fn4_A          162 HGLIGLTRSIAAHYGDQGIRAVAVLPGTVKTNIGLGSSKPSELGMRTLTKLMSLSSRLAEPEDIANVIVFLASDEASFVN  241 (254)
T ss_dssp             HHHHHHHHHHHHHHGGGTEEEEEEEECSBCSSCTTSCSSCCHHHHHHHHHHHTTCCCCBCHHHHHHHHHHHHSGGGTTCC
T ss_pred             HHHHHHHHHHHHHhhhhCeEEEEEEeCCCCCcccccccCCcHHHHHHHHhcCCCCCCCcCHHHHHHHHHHHhCchhcCCc
Confidence            9999999999999999999999999999999998665443 332333 33446789999999999999999999999999


Q ss_pred             ccEEEeCCCccc
Q 041276          232 GQTICVDGGFTV  243 (251)
Q Consensus       232 G~~i~vdgG~~~  243 (251)
                      ||.|.||||+++
T Consensus       242 G~~i~VDGG~t~  253 (254)
T 4fn4_A          242 GDAVVVDGGLTV  253 (254)
T ss_dssp             SCEEEESTTGGG
T ss_pred             CCEEEeCCCccc
Confidence            999999999986



>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 251
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 3e-73
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 1e-67
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 2e-63
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 9e-61
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 1e-59
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 1e-56
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 5e-56
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 1e-55
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 1e-54
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 3e-54
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 3e-54
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 2e-53
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 2e-53
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 7e-53
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 1e-52
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 2e-52
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 1e-51
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 5e-51
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 7e-51
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 8e-51
d1zmta1252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 3e-50
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 3e-49
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 4e-49
d2bgka1268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 5e-48
d1iy8a_258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 7e-48
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 9e-48
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 1e-47
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 1e-47
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 2e-47
d1gz6a_302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 4e-47
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 5e-47
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 7e-47
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 2e-46
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 4e-46
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 6e-46
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 1e-45
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 3e-45
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 6e-45
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 6e-45
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 3e-44
d1ulua_256 c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermoph 4e-43
d1gega_255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 8e-42
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 2e-41
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 3e-41
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 1e-39
d1k2wa_256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 1e-38
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 1e-37
d1qsga_258 c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli 2e-37
d1uaya_241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 3e-37
d1mxha_266 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 7e-35
d1oaaa_259 c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus 4e-34
d1fjha_257 c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase 8e-34
d2o23a1248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 2e-32
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 2e-31
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 3e-31
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 2e-27
d2pd4a1274 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacte 4e-27
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 2e-26
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 6e-26
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 2e-25
d1e7wa_284 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 6e-25
d1d7oa_297 c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (B 3e-22
d1snya_248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 3e-21
d2h7ma1268 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacteri 3e-19
d1uh5a_329 c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite 2e-17
d1luaa1191 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopter 2e-10
d2fr1a1259 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI 1e-05
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Tropinone reductase
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score =  222 bits (566), Expect = 3e-73
 Identities = 166/257 (64%), Positives = 194/257 (75%), Gaps = 21/257 (8%)

Query: 12  RWSLQGMTALVTGGTKGLG-------------------NEAELNECLREWKTKCFKVTGS 52
           RWSL+  T LVTGGTKG+G                   NE ELNECL +W+ K F+VTGS
Sbjct: 3   RWSLKAKTVLVTGGTKGIGHAIVEEFAGFGAVIHTCARNEYELNECLSKWQKKGFQVTGS 62

Query: 53  VCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTNFESA 112
           VCDAS R EREKLM+ VSS+F GKL+ILINN+G   + KPT++Y AED SF +STN ESA
Sbjct: 63  VCDASLRPEREKLMQTVSSMFGGKLDILINNLGAIRS-KPTLDYTAEDFSFHISTNLESA 121

Query: 113 YHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLAKNLACEWARDNI 172
           YHLSQLAHPLLKASG GNII +SS+ GV+S ++G+IY+ATKGA+NQLA+NLACEWA D I
Sbjct: 122 YHLSQLAHPLLKASGCGNIIFMSSIAGVVSASVGSIYSATKGALNQLARNLACEWASDGI 181

Query: 173 RINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPGEPKEVSSLVAFLCMPAASYITG 232
           R N+VAP  I TPL E    DE F + V  R P+ R GEP+EVSSLVAFLCMPAASYITG
Sbjct: 182 RANAVAPAVIATPLAEAVYDDE-FKKVVISRKPLGRFGEPEEVSSLVAFLCMPAASYITG 240

Query: 233 QTICVDGGFTVNGFFFR 249
           QTICVDGG TVNGF ++
Sbjct: 241 QTICVDGGLTVNGFSYQ 257


>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Length = 256 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 257 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Length = 274 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Length = 284 Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 297 Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Length = 268 Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 329 Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Length = 191 Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Length = 259 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 100.0
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 100.0
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 100.0
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 100.0
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 100.0
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 100.0
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 100.0
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 100.0
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 100.0
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 100.0
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 100.0
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 100.0
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 100.0
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 100.0
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 100.0
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 100.0
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 100.0
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 100.0
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 100.0
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 100.0
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 100.0
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 100.0
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 100.0
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 100.0
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 100.0
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 100.0
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 100.0
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 100.0
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 100.0
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 100.0
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 100.0
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 100.0
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 100.0
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 100.0
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 100.0
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 100.0
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 100.0
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 100.0
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 100.0
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 100.0
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 100.0
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 100.0
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 100.0
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 100.0
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 100.0
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 100.0
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 100.0
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 100.0
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 100.0
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 100.0
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 100.0
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 100.0
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 100.0
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 100.0
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 100.0
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 100.0
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 100.0
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 100.0
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 100.0
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 100.0
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 100.0
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 100.0
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 100.0
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.95
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.7
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.64
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.6
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.57
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.55
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.55
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.54
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.53
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.51
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.51
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.51
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.5
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.5
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.49
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.49
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.48
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.47
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.47
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.46
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.42
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.42
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.32
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.29
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.21
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.12
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 98.95
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 98.94
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 98.7
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 98.49
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 98.48
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 98.43
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 97.53
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.42
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.2
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.1
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.94
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 95.76
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 95.68
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 95.67
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 95.32
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 95.3
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 95.14
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 94.31
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 94.19
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 93.86
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.08
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 92.87
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 92.85
d2fr1a2209 Erythromycin synthase, eryAI, 1st ketoreductase mo 92.7
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 92.7
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 92.36
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 92.21
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 92.17
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 91.86
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 91.76
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 91.66
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 91.16
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 90.79
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 90.14
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 89.12
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 88.76
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 88.69
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 87.79
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 87.61
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 87.41
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 87.01
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 86.99
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 86.96
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 86.9
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 86.64
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 86.22
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 85.91
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 85.82
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 85.38
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 84.48
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 84.22
d2o14a2208 Hypothetical protein YxiM {Bacillus subtilis [TaxI 84.21
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 83.66
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 83.32
d2csua3163 Acetate-CoA ligase alpha chain, AcdA, domains 2 an 82.39
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 82.35
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 82.18
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 81.92
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 81.73
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 81.65
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: beta-keto acyl carrier protein reductase
species: Malaria parasite (Plasmodium falciparum) [TaxId: 5833]
Probab=100.00  E-value=1.2e-55  Score=355.93  Aligned_cols=230  Identities=26%  Similarity=0.440  Sum_probs=213.9

Q ss_pred             CCcccCCCCCEEEEecCCCCcC-------------------cHHHHHHHHHHHHhcCCeeEEEeccCCCHHHHHHHHHHH
Q 041276            9 RQDRWSLQGMTALVTGGTKGLG-------------------NEAELNECLREWKTKCFKVTGSVCDASSRAEREKLMKQV   69 (251)
Q Consensus         9 ~~~~~~l~~k~vlItGas~giG-------------------~~~~~~~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~i   69 (251)
                      .+..+++++|++|||||++|||                   +.+.++++.+++++.+.++.++.+|++++++++++++++
T Consensus         2 ~n~~f~lenKvalITGas~GIG~a~a~~la~~Ga~V~~~~r~~~~l~~~~~~l~~~g~~~~~~~~Dvt~~~~v~~~~~~~   81 (251)
T d2c07a1           2 ENYYYCGENKVALVTGAGRGIGREIAKMLAKSVSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKI   81 (251)
T ss_dssp             CCCCCCCSSCEEEEESTTSHHHHHHHHHHTTTSSEEEEEESSHHHHHHHHHHHHTTTCCEEEEECCTTCHHHHHHHHHHH
T ss_pred             CccccCCCCCEEEEeCCCCHHHHHHHHHHHHcCCEEEEEECCHHHHHHHHHHHHhcCCcEEEEEccCCCHHHHHHHHHHH
Confidence            4567889999999999999999                   678889999999988889999999999999999999999


Q ss_pred             HHhcCCCccEEEEcccCCCCCCCCCCCCHHHHHHHHHhhhHHHHHHHHHHHHHHHhCCCceEEEecccccccCCCCChhh
Q 041276           70 SSLFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTNFESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIY  149 (251)
Q Consensus        70 ~~~~~~~id~lv~~ag~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~m~~~~~g~iv~vss~~~~~~~~~~~~Y  149 (251)
                      .+++ +++|+||||||... ..++.+.+.++|++.+++|+.++++++++++|+|++++.|+||++||.++..+.++...|
T Consensus        82 ~~~~-g~iDilvnnag~~~-~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IVnisS~~~~~~~~~~~~Y  159 (251)
T d2c07a1          82 LTEH-KNVDILVNNAGITR-DNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVGLTGNVGQANY  159 (251)
T ss_dssp             HHHC-SCCCEEEECCCCCC-CCCTTTCCHHHHHHHHHHHTTHHHHHHHHHHHHHHHHTCEEEEEECCTHHHHCCTTCHHH
T ss_pred             HHhc-CCceeeeecccccc-ccccccccHHHHhhhheeeehhhhhhhhhcCcccccCCCeEEEEECCHHhcCCCCCCHHH
Confidence            9999 89999999999876 778889999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhHHHHHHHHHHHHHHHccCCeEEEEEecCcccCCCCCCCCCCHHHHHHHhhCCCCCCCCCHHHHHHHHHHHcCCCCCC
Q 041276          150 AATKGAMNQLAKNLACEWARDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPGEPKEVSSLVAFLCMPAASY  229 (251)
Q Consensus       150 ~~sK~a~~~~~~~la~e~~~~~i~v~~i~pG~v~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dva~~~~~l~~~~~~~  229 (251)
                      ++||+|+.+|+|++|.|++++|||||+|+||+++|+|....  .++..+.+....|++|+++|+|+|+.++||+|+++++
T Consensus       160 ~asKaal~~ltr~lA~el~~~gIrVN~V~PG~v~T~~~~~~--~~~~~~~~~~~~pl~R~~~pedvA~~v~fL~S~~s~~  237 (251)
T d2c07a1         160 SSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSDMTDKI--SEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGY  237 (251)
T ss_dssp             HHHHHHHHHHHHHHHHHHGGGTEEEEEEEECSBCC-----C--CHHHHHHHHTTCTTSSCBCHHHHHHHHHHHHSGGGTT
T ss_pred             HHHHHHHHHHHHHHHHHhhhhCeEEEEEccCCEeccccccc--CHHHHHHHHhcCCCCCCcCHHHHHHHHHHHhCchhCC
Confidence            99999999999999999999999999999999999998765  4677888889999999999999999999999999999


Q ss_pred             ccccEEEeCCCcc
Q 041276          230 ITGQTICVDGGFT  242 (251)
Q Consensus       230 ~~G~~i~vdgG~~  242 (251)
                      +|||+|.||||++
T Consensus       238 itG~~i~vDGG~s  250 (251)
T d2c07a1         238 INGRVFVIDGGLS  250 (251)
T ss_dssp             CCSCEEEESTTSC
T ss_pred             CcCcEEEECCCcC
Confidence            9999999999975



>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2fr1a2 c.2.1.2 (A:1448-1656) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o14a2 c.23.10.8 (A:160-367) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure