Citrus Sinensis ID: 041276

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MAQAYDHDRQDRWSLQGMTALVTGGTKGLGNEAELNECLREWKTKCFKVTGSVCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTNFESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLAKNLACEWARDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPGEPKEVSSLVAFLCMPAASYITGQTICVDGGFTVNGFFFRRT
ccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHHHHcccCEEEEEcccccHHHHHHHHHHHHHHccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccEEEEcccccccccccccc
*************SLQGMTALVTGGTKGLGNEAELNECLREWKTKCFKVTGSVCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTNFESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLAKNLACEWARDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPGEPKEVSSLVAFLCMPAASYITGQTICVDGGFTVNGFFFR**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQAYDHDRQDRWSLQGMTALVTGGTKGLGNEAELNECLREWKTKCFKVTGSVCDASSRAEREKLMKQVSSLFNGKLNILINNVGTNYTTKPTVEYMAEDLSFLMSTNFESAYHLSQLAHPLLKASGAGNIILVSSVCGVLSTNLGTIYAATKGAMNQLAKNLACEWARDNIRINSVAPWFITTPLTEPYLSDEKFLEEVKCRTPMERPGEPKEVSSLVAFLCMPAASYITGQTICVDGGFTVNGFFFRRT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tropinone reductase 1 Catalyzes the stereospecific reduction of tropinone to tropine.probableP50162
Tropinone reductase 2 Catalyzes the stereospecific reduction of tropinone to pseudotropine.probableP50163
3-oxoacyl-[acyl-carrier-protein] reductase FabG Catalyzes the NADPH-dependent reduction of beta-ketoacyl-ACP substrates to beta-hydroxyacyl-ACP products, the first reductive step in the elongation cycle of fatty acid biosynthesis.probableQ5HGK2

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.1.-.-Acting on the CH-OH group of donors.probable
1.1.1.-15-hydroxyprostaglandin dehydrogenase (NAD(+)).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XQ1, chain A
Confidence level:very confident
Coverage over the Query: 10-134,145-183,210-251
View the alignment between query and template
View the model in PyMOL