Citrus Sinensis ID: 041340

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MVVAQEFTVDLNKPLVFQVGHLGEAYQEWVHQPIVSKEGPRFFESDFWEFLTLTVWWAIPVIWLPVVCWCISMSIRMGQTLPHVALMVLFGIFVWTLLEYTLHRFLFHIKTKEGNTIHYLLHGCHHKHPMDGLRLVFPPAATAVLLLPFWKVLSLVSTPTTTPALFGGGLLGYVMYDVTHYYLHHGQPSSEVPKNLKKYHLNHHFRIQNKGFGITSSLWDRVFGTLPQTKAAEKSK
ccccccccccccccHHHHHHHcHHHHHHHHccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHEEEEEEEEcccccccccHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccccCCHHHHHHcccccccccccccc
****QEFTVDLNKPLVFQVGHLGEAYQEWVHQPIVSKEGPRFFESDFWEFLTLTVWWAIPVIWLPVVCWCISMSIRMGQTLPHVALMVLFGIFVWTLLEYTLHRFLFHIKTKEGNTIHYLLHGCHHKHPMDGLRLVFPPAATAVLLLPFWKVLSLVSTPTTTPALFGGGLLGYVMYDVTHYYLHHGQPSSEVPKNLKKYHLNHHFRIQNKGFGITSSLWDRVFGTL**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVAQEFTVDLNKPLVFQVGHLGEAYQEWVHQPIVSKEGPRFFESDFWEFLTLTVWWAIPVIWLPVVCWCISMSIRMGQTLPHVALMVLFGIFVWTLLEYTLHRFLFHIKTKEGNTIHYLLHGCHHKHPMDGLRLVFPPAATAVLLLPFWKVLSLVSTPTTTPALFGGGLLGYVMYDVTHYYLHHGQPSSEVPKNLKKYHLNHHFRIQNKGFGITSSLWDRVFGTLPQTKAAEKSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Fatty acid 2-hydroxylase 1 Fatty acid 2-hydroxylase involved in the alpha-hydroxylation of sphingolipid-associated very long-chain fatty acids (VLCFA). Probably involved in the resistance response to oxidative stress.confidentO48916
Fatty acid 2-hydroxylase 2 Fatty acid 2-hydroxylase involved in the alpha-hydroxylation of the long-chain fatty acid (LCFA) palmitic acid. Probably involved in the resistance response to oxidative stress.probableQ9SUC5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted