Citrus Sinensis ID: 041376


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MADVLRSGIVHCNDTCGCPVPCPGGAACSCSTVAYSEYYHKCCSCGGHCSCNPCTCSKIQANKIGKAHCSCGTACKCPT
ccccccccEEECccccccccccccccccEECcccccccccCCccccccccccccccccHHHcccccEEccccccccccc
*******GIVHCNDTCGCPVPCPGGAACSCST*******HKCCSCGGHCSCNPCTCSKIQANKIGKAHCSCGTACKCP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADVLRSGIVHCNDTCGCPVPCPGGAACSCSTVAYSEYYHKCCSCGGHCSCNPCTCSKIQANKIGKAHCSCGTACKCPT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
EC protein homolog 2 Binds 5 molecules of zinc. May have a role in Zn(2+) homeostasis during embryogenesis.probableQ42377
Class II metallothionein-like protein 1A Metallothioneins have a high content of cysteine residues that bind various heavy metals.probableQ109B0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KAK, chain A
Confidence level:very confident
Coverage over the Query: 52-63
View the alignment between query and template
View the model in PyMOL
Template: 2L61, chain A
Confidence level:confident
Coverage over the Query: 10-32
View the alignment between query and template
View the model in PyMOL