Citrus Sinensis ID: 041395

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MGPVVAVVPPRFWHFFLILSMGFVGINGQVNRWLNAHATYYGADQSPSTLGGACGYDNTIHAGFGVNTAAVSGVLFRGGQACGACYQLMCDYRADPKWCLRHATVTLTATNFCPPNNHGGWCDPPRQHFDMSMPAFFRIARQGNEGIVPILYKRVACKRRGGVHFTLKGQSNFNMVMFSNVGGSGDLKGAWVRGSRTKTWIAMQRNWGANWSSSVDLRIQRLSFKLTLVDGRTQLFFNVVPSSWSFGQTFSSRNQFY
cccccccHHHHHHHHHHHHHHHHcccccccccEEEEEEEEccccccccccccccccccccccccccEEEEcccccccccccccccEEEEccccccccccccccEEEEEEcccccccccccccccccccccccHHHHHHHHHcccccEEcEEEEEEECcccccEEEEEccccccEEEEEEECcccccEEEEEEEcccccccEEcccccccEEEEccccccccEEEEEEEccccEEEEEEECccccccccEECcccccc
***VVAVVPPRFWHFFLILSMGFVGINGQVNRWLNAHATYYGADQSPSTLGGACGYDNTIHAGFGVNTAAVSGVLFRGGQACGACYQLMCDYRADPKWCLRHATVTLTATNFCPPNNHGGWCDPPRQHFDMSMPAFFRIARQGNEGIVPILYKRVACKRRGGVHFTLKGQSNFNMVMFSNVGGSGDLKGAWVRGSRTKTWIAMQRNWGANWSSSVDLRIQRLSFKLTLVDGRTQLFFNVVPSSWSFGQTFSSRNQFY
xxxxxxxxxxxHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGPVVAVVPPRFWHFFLILSMGFVGINGQVNRWLNAHATYYGADQSPSTLGGACGYDNTIHAGFGVNTAAVSGVLFRGGQACGACYQLMCDYRADPKWCLRHATVTLTATNFCPPNNHGGWCDPPRQHFDMSMPAFFRIARQGNEGIVPILYKRVACKRRGGVHFTLKGQSNFNMVMFSNVGGSGDLKGAWVRGSRTKTWIAMQRNWGANWSSSVDLRIQRLSFKLTLVDGRTQLFFNVVPSSWSFGQTFSSRNQFY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Expansin-A12 Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found.probableQ9LDJ3
Expansin-A1 May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence.probableQ7XWU8
Expansin-A4 Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. Required for normal plant growth. May be required for rapid internodal elongation in deepwater rice during submergence.probableA2Y5R6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HCZ, chain X
Confidence level:very confident
Coverage over the Query: 30-257
View the alignment between query and template
View the model in PyMOL