Citrus Sinensis ID: 041421

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----
MNQIAGVFARRKYNIESLAAIGLDKDRALFTIVVSGTDRELQQVVEQLQKLVNVLNVSTKQSSSSSSLEPFFLPFSGVDSTTDSVVTQPCKHQMDELEMIRVFKENIPSVVLIGNLGIRDGNGEGRGGDQSPHTHSRYFAEDQSETQFLQASGAGFLWDQDGHIVTNHHVICDASKVKVSFSDQSTFYAKVVGHDQDKDLAVLHIDAPNHELRPIHVGVSADLHVGQKICAIGHPLGLPFTCTTGVISALGREIPAGTGRLIRGVIQIDASINLGNSGGPLLDSSGSLIGVNTFITSGAFTGIGFATPIDTAVLV
ccccccEEccccccccccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccEEEEEEEEEEccccccccccccccccccccccccccccccccEEEEEEccccEEEccccccccccEEEEEEccccEEEEEEEEccccccEEEEEEEccccccccEEcccccccccccEEEEEcccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccEEEEEcccccccccEEEEEEEccccccc
cccHHHHHHHHHccHHHHHHHccccccEEEEEEHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccccccccHHHHHHHHcccEEEEEEEEEEcccccccccccccHHHHHHccccccccccccccccEEEEccccEEEEcccEEccccEEEEEEccccEEEEEEEEccccccEEEEEEccccccccEEEEccccccccccEEEEEcccccccccEEEEEEEEcccccccccccccccEEEEccEEcccccccEEEEccccEEEEEEEEEccccccEEEEEEHHHHccc
MNQIAGVFARRKYNIESLAaigldkdraLFTIVVSGTDRELQQVVEQLQKLVNVLNVstkqsssssslepfflpfsgvdsttdsvvtqpckhqmdELEMIRVFKENIPSVVLIgnlgirdgngegrggdqsphthsryfaedqseTQFLQAsgagflwdqdghivtnHHVIcdaskvkvsfsdqSTFYAKVVghdqdkdlavlhidapnhelrpihvgvsadLHVGQKICaighplglpftcTTGVISAlgreipagtgrlIRGVIqidasinlgnsggplldssgsligvntfitsgaftgigfatpidtavlv
mnqiagvfarrkynieslaaigldkdrALFTIVVSGTDRELQQVVEQLQKLVNVLNVStkqsssssslEPFFLPFSGVDSTTDSVVTQPCKHQMDELEMIRVFKENIPSVVLIGNLGIRDGNGEGRGGDQSPHTHSRYFAEDQSETQFLQASGAGFLWDQDGHIVTNHHVICDASKVKVSFSDQSTFYAKVVGHDQDKDLAVLHIDAPNHELRPIHVGVSADLHVGQKICAIGHPLGLPFTCTTGVISALGREIPAGTGRLIRGVIQIDASINLGNSGGPLLDSSGSLIGVNTFITSGAFTGIGFATPIDTAVLV
MNQIAGVFARRKYNIESLAAIGLDKDRALFTIVVSGTDRelqqvveqlqklvnvlnvSTKQsssssslepfflpfsGVDSTTDSVVTQPCKHQMDELEMIRVFKENIPSVVLIGNLgirdgngegrggdQSPHTHSRYFAEDQSETQFLQASGAGFLWDQDGHIVTNHHVICDASKVKVSFSDQSTFYAKVVGHDQDKDLAVLHIDAPNHELRPIHVGVSADLHVGQKICAIGHPLGLPFTCTTGVISALGREIPAGTGRLIRGVIQIDASINlgnsggplldssgslIGVNTFITSGAFTGIGFATPIDTAVLV
***IAGVFARRKYNIESLAAIGLDKDRALFTIVVSGTDRELQQVVEQLQKLVNVLNV*************FFLPFSGVDSTTDSVVTQPCKHQMDELEMIRVFKENIPSVVLIGNLGIR****************************FLQASGAGFLWDQDGHIVTNHHVICDASKVKVSFSDQSTFYAKVVGHDQDKDLAVLHIDAPNHELRPIHVGVSADLHVGQKICAIGHPLGLPFTCTTGVISALGREIPAGTGRLIRGVIQIDASINLGNSGGPLLDSSGSLIGVNTFITSGAFTGIGFATPIDTAV**
*****GVFARRKYNIESLAAIGLDKDRALFTIV******************VNVLNVSTKQSSSSSSL*****************************EMIRVFKENIPSVVLIGN*****************************************LWDQDGHIVTNHHVICDASKVKVSFSDQSTFYAKVVGHDQDKDLAVLHIDAPNHELRPIHVGVSADLHVGQKICAIGHPLGLPFTCTTGVISALGREIPAGTGRLIRGVIQIDASINLGNSGGPLLDSSGSLIGVNTFITSGAFTGIGFATPIDTAVLV
MNQIAGVFARRKYNIESLAAIGLDKDRALFTIVVSGTDRELQQVVEQLQKLVNVLNV**********LEPFFLPFSGVDSTTDSVVTQPCKHQMDELEMIRVFKENIPSVVLIGNLGIRDGNG**********THSRYFAEDQSETQFLQASGAGFLWDQDGHIVTNHHVICDASKVKVSFSDQSTFYAKVVGHDQDKDLAVLHIDAPNHELRPIHVGVSADLHVGQKICAIGHPLGLPFTCTTGVISALGREIPAGTGRLIRGVIQIDASINLGNSGGPLLDSSGSLIGVNTFITSGAFTGIGFATPIDTAVLV
*NQIAGVFARRKYNIESLAAIGLDKDRALFTIVVSGTDRELQQVVEQLQKLVNVLNVSTKQSSSSSSLEPFFLPFSGVDSTTDSVVTQPCKHQMDELEMIRVFKENIPSVVLIGNLGIRDGNGEGRGGDQSPHTHSRYFAEDQS******ASGAGFLWDQDGHIVTNHHVICDASKVKVSFSDQSTFYAKVVGHDQDKDLAVLHIDAPNHELRPIHVGVSADLHVGQKICAIGHPLGLPFTCTTGVISALGREIPAGTGRLIRGVIQIDASINLGNSGGPLLDSSGSLIGVNTFITSGAFTGIGFATPIDTAVLV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQIAGVFARRKYNIESLAAIGLDKDRALFTIVVSGTDRELQQVVEQLQKLVNVLNVSTKQSSSSSSLEPFFLPFSGVDSTTDSVVTQPCKHQMDELEMIRVFKENIPSVVLIGNLGIRDGNGEGRGGDQSPHTHSRYFAEDQSETQFLQASGAGFLWDQDGHIVTNHHVICDASKVKVSFSDQSTFYAKVVGHDQDKDLAVLHIDAPNHELRPIHVGVSADLHVGQKICAIGHPLGLPFTCTTGVISALGREIPAGTGRLIRGVIQIDASINLGNSGGPLLDSSGSLIGVNTFITSGAFTGIGFATPIDTAVLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query315 2.2.26 [Sep-21-2011]
O22609 439 Protease Do-like 1, chlor yes no 0.723 0.519 0.545 4e-64
Q9SEL7323 Protease Do-like 5, chlor no no 0.634 0.619 0.441 1e-38
Q9LU10 448 Protease Do-like 8, chlor no no 0.526 0.370 0.491 3e-37
Q2SL36 469 Probable periplasmic seri yes no 0.571 0.383 0.386 3e-32
B1J4D7 479 Probable periplasmic seri yes no 0.552 0.363 0.407 3e-31
A5W8F5 477 Probable periplasmic seri yes no 0.552 0.364 0.407 3e-31
Q4KGQ4 476 Probable periplasmic seri yes no 0.517 0.342 0.427 3e-31
B0KV30 477 Probable periplasmic seri yes no 0.552 0.364 0.396 1e-30
E1V4H2 474 Probable periplasmic seri yes no 0.584 0.388 0.391 2e-30
P73940 416 Putative serine protease N/A no 0.688 0.521 0.419 2e-30
>sp|O22609|DEGP1_ARATH Protease Do-like 1, chloroplastic OS=Arabidopsis thaliana GN=DEGP1 PE=1 SV=2 Back     alignment and function desciption
 Score =  244 bits (624), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 143/262 (54%), Positives = 175/262 (66%), Gaps = 34/262 (12%)

Query: 66  SSLEPFFL-------PFS------GVDSTTDSVVTQPCKHQMDELEMIRVFKENIPSVVL 112
           S+++PFFL        FS       V+S +  VV+ P K Q DEL  +R+F+EN PSVV 
Sbjct: 75  SAVKPFFLLCTSVALSFSLFAASPAVESASAFVVSTPKKLQTDELATVRLFQENTPSVVY 134

Query: 113 IGNLGIRDGNGEGRGGDQSPHTHSRYFAEDQSETQFLQASGAGFLWDQDGHIVTNHHVIC 172
           I NL +R                   F  D  E    Q SG+GF+WD+ GHIVTN+HVI 
Sbjct: 135 ITNLAVRQDA----------------FTLDVLEVP--QGSGSGFVWDKQGHIVTNYHVIR 176

Query: 173 DASKVKVSFSDQSTFYAKVVGHDQDKDLAVLHIDAPNHELRPIHVGVSADLHVGQKICAI 232
            AS ++V+ +DQ+TF AKVVG DQDKD+AVL IDAP ++LRPI VGVSADL VGQK+ AI
Sbjct: 177 GASDLRVTLADQTTFDAKVVGFDQDKDVAVLRIDAPKNKLRPIPVGVSADLLVGQKVFAI 236

Query: 233 GHPLGLPFTCTTGVISALGREI-PAGTGRLIRGVIQIDASINLGNSGGPLLDSSGSLIGV 291
           G+P GL  T TTGVIS L REI  A TGR I+ VIQ DA+IN GNSGGPLLDSSG+LIG+
Sbjct: 237 GNPFGLDHTLTTGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGTLIGI 296

Query: 292 NTFI--TSGAFTGIGFATPIDT 311
           NT I   SGA +G+GF+ P+DT
Sbjct: 297 NTAIYSPSGASSGVGFSIPVDT 318
Serine protease that is required at high temperature. May be involved in the degradation of damaged proteins. In vivo, can degrade beta-casein.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -
>sp|Q9SEL7|DEGP5_ARATH Protease Do-like 5, chloroplastic OS=Arabidopsis thaliana GN=DEGP5 PE=1 SV=3 Back     alignment and function description
>sp|Q9LU10|DEGP8_ARATH Protease Do-like 8, chloroplastic OS=Arabidopsis thaliana GN=DEGP8 PE=1 SV=1 Back     alignment and function description
>sp|Q2SL36|DEGPL_HAHCH Probable periplasmic serine endoprotease DegP-like OS=Hahella chejuensis (strain KCTC 2396) GN=mucD PE=3 SV=1 Back     alignment and function description
>sp|B1J4D7|DEGPL_PSEPW Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas putida (strain W619) GN=PputW619_1070 PE=3 SV=1 Back     alignment and function description
>sp|A5W8F5|DEGPL_PSEP1 Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=Pput_4291 PE=3 SV=1 Back     alignment and function description
>sp|Q4KGQ4|DEGPL_PSEF5 Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=mucD PE=1 SV=1 Back     alignment and function description
>sp|B0KV30|DEGPL_PSEPG Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas putida (strain GB-1) GN=PputGB1_4377 PE=3 SV=1 Back     alignment and function description
>sp|E1V4H2|DEGPL_HALED Probable periplasmic serine endoprotease DegP-like OS=Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) GN=mucD PE=3 SV=1 Back     alignment and function description
>sp|P73940|HHOB_SYNY3 Putative serine protease HhoB OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hhoB PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query315
449450105 439 PREDICTED: protease Do-like 1, chloropla 0.730 0.523 0.565 8e-63
449483759 438 PREDICTED: protease Do-like 1, chloropla 0.730 0.525 0.565 1e-62
357495999 432 Serine-type peptidase [Medicago truncatu 0.695 0.506 0.575 1e-62
2565436 437 DegP protease precursor [Arabidopsis tha 0.723 0.521 0.545 1e-62
359493091 428 PREDICTED: protease Do-like 1, chloropla 0.707 0.521 0.569 2e-62
22331378 439 protease Do-like 1 [Arabidopsis thaliana 0.723 0.519 0.545 3e-62
270342123 424 serine-type peptidase [Phaseolus vulgari 0.707 0.525 0.561 6e-62
388496926377 unknown [Lotus japonicus] 0.707 0.591 0.561 1e-61
297818398 433 hypothetical protein ARALYDRAFT_484581 [ 0.723 0.526 0.546 1e-61
224060070361 predicted protein [Populus trichocarpa] 0.707 0.617 0.566 2e-61
>gi|449450105|ref|XP_004142804.1| PREDICTED: protease Do-like 1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  246 bits (629), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 142/251 (56%), Positives = 170/251 (67%), Gaps = 21/251 (8%)

Query: 64  SSSSLEPFFLPFSGVDSTTDSVVTQPCKHQMDELEMIRVFKENIPSVVLIGNLGIRDGNG 123
           S+S L  F L  + VD     VVT P K Q DEL  +R+F+EN PSVV I NL +R    
Sbjct: 86  STSVLLSFALFVTDVDPAVAFVVTTPRKLQTDELATVRLFQENTPSVVYITNLAVRQD-- 143

Query: 124 EGRGGDQSPHTHSRYFAEDQSETQFLQASGAGFLWDQDGHIVTNHHVICDASKVKVSFSD 183
                          F  D  E    Q SG+GF+WD+DGHIVTN+HVI  AS ++V+ +D
Sbjct: 144 --------------AFTLDVLEVP--QGSGSGFVWDKDGHIVTNYHVIRGASDLRVTLAD 187

Query: 184 QSTFYAKVVGHDQDKDLAVLHIDAPNHELRPIHVGVSADLHVGQKICAIGHPLGLPFTCT 243
           Q+TF AKVVG DQDKD+AVL IDAP  +LRPI VG+SADL VGQK+ AIG+P GL  T T
Sbjct: 188 QTTFDAKVVGFDQDKDVAVLSIDAPKDKLRPIPVGISADLLVGQKVFAIGNPFGLDHTLT 247

Query: 244 TGVISALGREI-PAGTGRLIRGVIQIDASINLGNSGGPLLDSSGSLIGVNTFI--TSGAF 300
           TGVIS L REI  A TGR I+ VIQ DA+IN GNSGGPLLDSSG+LIG+NT I   SGA 
Sbjct: 248 TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS 307

Query: 301 TGIGFATPIDT 311
           +G+GF+ P+DT
Sbjct: 308 SGVGFSIPVDT 318

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449483759|ref|XP_004156682.1| PREDICTED: protease Do-like 1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357495999|ref|XP_003618288.1| Serine-type peptidase [Medicago truncatula] gi|355493303|gb|AES74506.1| Serine-type peptidase [Medicago truncatula] gi|388511665|gb|AFK43894.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|2565436|gb|AAC39436.1| DegP protease precursor [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359493091|ref|XP_002267510.2| PREDICTED: protease Do-like 1, chloroplastic-like [Vitis vinifera] gi|296081154|emb|CBI18180.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|22331378|ref|NP_189431.2| protease Do-like 1 [Arabidopsis thaliana] gi|51338737|sp|O22609.2|DEGP1_ARATH RecName: Full=Protease Do-like 1, chloroplastic; Flags: Precursor gi|11994498|dbj|BAB02539.1| DegP protease precursor [Arabidopsis thaliana] gi|14517500|gb|AAK62640.1| K16N12.18/K16N12.18 [Arabidopsis thaliana] gi|21360531|gb|AAM47381.1| At3g27925/K16N12.18 [Arabidopsis thaliana] gi|332643860|gb|AEE77381.1| protease Do-like 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|270342123|gb|ACZ74706.1| serine-type peptidase [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|388496926|gb|AFK36529.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|297818398|ref|XP_002877082.1| hypothetical protein ARALYDRAFT_484581 [Arabidopsis lyrata subsp. lyrata] gi|297322920|gb|EFH53341.1| hypothetical protein ARALYDRAFT_484581 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224060070|ref|XP_002300036.1| predicted protein [Populus trichocarpa] gi|222847294|gb|EEE84841.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query315
TAIR|locus:2086420 439 DEG1 "degradation of periplasm 0.514 0.369 0.593 6.1e-52
UNIPROTKB|Q607N4 374 MCA1725 "Putative serine prote 0.514 0.433 0.445 3.7e-32
TAIR|locus:2124509323 DEG5 "degradation of periplasm 0.574 0.560 0.431 2.3e-30
TAIR|locus:2151916 448 DEG8 "degradation of periplasm 0.526 0.370 0.425 6.4e-28
UNIPROTKB|O05942 513 htrA "Probable periplasmic ser 0.504 0.309 0.411 8.1e-24
UNIPROTKB|Q92JA1 508 htrA "Probable periplasmic ser 0.542 0.336 0.388 1.3e-23
UNIPROTKB|Q74GB5 464 degP "Periplasmic trypsin-like 0.542 0.368 0.380 2.4e-23
TIGR_CMR|GSU_0331 464 GSU_0331 "trypsin domain/PDZ d 0.542 0.368 0.380 2.4e-23
UNIPROTKB|P0A3Z5 513 htrA "Probable periplasmic ser 0.504 0.309 0.390 2.9e-23
UNIPROTKB|P0C114 513 htrA "Probable periplasmic ser 0.504 0.309 0.390 2.9e-23
TAIR|locus:2086420 DEG1 "degradation of periplasmic proteins 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 462 (167.7 bits), Expect = 6.1e-52, Sum P(2) = 6.1e-52
 Identities = 98/165 (59%), Positives = 119/165 (72%)

Query:   150 QASGAGFLWDQDGHIVTNHHVICDASKVKVSFSDQSTFYAKVVGHDQDKDLAVLHIDAPN 209
             Q SG+GF+WD+ GHIVTN+HVI  AS ++V+ +DQ+TF AKVVG DQDKD+AVL IDAP 
Sbjct:   154 QGSGSGFVWDKQGHIVTNYHVIRGASDLRVTLADQTTFDAKVVGFDQDKDVAVLRIDAPK 213

Query:   210 HELRPIHVGVSADLHVGQKICAIGHPLGLPFTCTTGVISALGREIP-AGTGRLIRGVIQI 268
             ++LRPI VGVSADL VGQK+ AIG+P GL  T TTGVIS L REI  A TGR I+ VIQ 
Sbjct:   214 NKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLTTGVISGLRREISSAATGRPIQDVIQT 273

Query:   269 DASINXXXXXXXXXXXXXXXIGVNTFI--TSGAFTGIGFATPIDT 311
             DA+IN               IG+NT I   SGA +G+GF+ P+DT
Sbjct:   274 DAAINPGNSGGPLLDSSGTLIGINTAIYSPSGASSGVGFSIPVDT 318
GO:0003824 "catalytic activity" evidence=IEA
GO:0004252 "serine-type endopeptidase activity" evidence=IEA;IDA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008236 "serine-type peptidase activity" evidence=ISS;IDA
GO:0009543 "chloroplast thylakoid lumen" evidence=IDA
GO:0031977 "thylakoid lumen" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0030163 "protein catabolic process" evidence=TAS
GO:0005634 "nucleus" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0010206 "photosystem II repair" evidence=IMP
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0010304 "PSII associated light-harvesting complex II catabolic process" evidence=RCA
GO:0015996 "chlorophyll catabolic process" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
UNIPROTKB|Q607N4 MCA1725 "Putative serine protease" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
TAIR|locus:2124509 DEG5 "degradation of periplasmic proteins 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151916 DEG8 "degradation of periplasmic proteins 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O05942 htrA "Probable periplasmic serine endoprotease DegP-like" [Rickettsia prowazekii str. Madrid E (taxid:272947)] Back     alignment and assigned GO terms
UNIPROTKB|Q92JA1 htrA "Probable periplasmic serine endoprotease DegP-like" [Rickettsia conorii str. Malish 7 (taxid:272944)] Back     alignment and assigned GO terms
UNIPROTKB|Q74GB5 degP "Periplasmic trypsin-like serine protease DegP" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0331 GSU_0331 "trypsin domain/PDZ domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P0A3Z5 htrA "Probable periplasmic serine endoprotease DegP-like" [Brucella suis 1330 (taxid:204722)] Back     alignment and assigned GO terms
UNIPROTKB|P0C114 htrA "Probable periplasmic serine endoprotease DegP-like" [Brucella abortus bv. 1 str. 9-941 (taxid:262698)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.691
3rd Layer2.2.1LOW CONFIDENCE prediction!
4th Layer2.2.1.6LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
TIGR02037 428 TIGR02037, degP_htrA_DO, periplasmic serine protea 5e-52
COG0265 347 COG0265, DegQ, Trypsin-like serine proteases, typi 3e-41
TIGR02038 351 TIGR02038, protease_degS, periplasmic serine pepet 9e-35
PRK10942 473 PRK10942, PRK10942, serine endoprotease; Provision 3e-33
PRK10139 455 PRK10139, PRK10139, serine endoprotease; Provision 1e-32
PRK10898 353 PRK10898, PRK10898, serine endoprotease; Provision 3e-32
pfam13365138 pfam13365, Trypsin_2, Trypsin-like peptidase domai 2e-21
pfam00089218 pfam00089, Trypsin, Trypsin 4e-18
cd0487872 cd04878, ACT_AHAS, N-terminal ACT domain of the Es 3e-17
PRK11895161 PRK11895, ilvH, acetolactate synthase 3 regulatory 7e-15
COG0440163 COG0440, IlvH, Acetolactate synthase, small (regul 3e-12
CHL00100174 CHL00100, ilvH, acetohydroxyacid synthase small su 2e-11
TIGR00119157 TIGR00119, acolac_sm, acetolactate synthase, small 4e-11
pfam1371063 pfam13710, ACT_5, ACT domain 3e-09
PRK0817896 PRK08178, PRK08178, acetolactate synthase 1 regula 3e-05
PRK0673776 PRK06737, PRK06737, acetolactate synthase 1 regula 6e-04
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information 
 Score =  176 bits (449), Expect = 5e-52
 Identities = 85/223 (38%), Positives = 116/223 (52%), Gaps = 22/223 (9%)

Query: 102 VFKENIPSVVLIGNLGIR---------DGNGEGRGGDQSPHTHSRYFAEDQSETQFLQAS 152
           + ++  P+VV I   G                   GD  P          Q   Q ++  
Sbjct: 6   LVEKVAPAVVNISVEGTVKRRNRPPALPPFFRQFFGDDMP------DFPRQQREQKVRGL 59

Query: 153 GAGFLWDQDGHIVTNHHVICDASKVKVSFSDQSTFYAKVVGHDQDKDLAVLHIDAPNHEL 212
           G+G +   DG+++TN+HV+  A ++ V+ SD   F AK+VG D   D+AVL IDA    L
Sbjct: 60  GSGVIISADGYVLTNNHVVDGADEITVTLSDGREFKAKLVGKDPRTDIAVLKIDAKK-NL 118

Query: 213 RPIHVGVSADLHVGQKICAIGHPLGLPFTCTTGVISALGR-EIPAGTGRLIRGVIQIDAS 271
             I +G S  L VG  + AIG+P GL  T T+G++SALGR  +  G        IQ DA+
Sbjct: 119 PVIKLGDSDKLRVGDWVLAIGNPFGLGQTVTSGIVSALGRSGLGIGD---YENFIQTDAA 175

Query: 272 INLGNSGGPLLDSSGSLIGVNTFITS--GAFTGIGFATPIDTA 312
           IN GNSGGPL++  G +IG+NT I S  G   GIGFA P + A
Sbjct: 176 INPGNSGGPLVNLRGEVIGINTAILSPSGGNVGIGFAIPSNMA 218

This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides]. Length = 428
>gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233696 TIGR02038, protease_degS, periplasmic serine pepetdase DegS Back     alignment and domain information
>gnl|CDD|236802 PRK10942, PRK10942, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|182262 PRK10139, PRK10139, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|182820 PRK10898, PRK10898, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|153150 cd04878, ACT_AHAS, N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>gnl|CDD|183365 PRK11895, ilvH, acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>gnl|CDD|223517 COG0440, IlvH, Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|214364 CHL00100, ilvH, acetohydroxyacid synthase small subunit Back     alignment and domain information
>gnl|CDD|129225 TIGR00119, acolac_sm, acetolactate synthase, small subunit Back     alignment and domain information
>gnl|CDD|222334 pfam13710, ACT_5, ACT domain Back     alignment and domain information
>gnl|CDD|236174 PRK08178, PRK08178, acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180675 PRK06737, PRK06737, acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 315
PRK10139 455 serine endoprotease; Provisional 100.0
PRK10942 473 serine endoprotease; Provisional 100.0
TIGR02038 351 protease_degS periplasmic serine pepetdase DegS. T 100.0
PRK10898 353 serine endoprotease; Provisional 100.0
TIGR02037 428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 100.0
COG0265 347 DegQ Trypsin-like serine proteases, typically peri 99.94
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 99.91
PRK0817896 acetolactate synthase 1 regulatory subunit; Review 99.9
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 99.89
COG0440163 IlvH Acetolactate synthase, small (regulatory) sub 99.88
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 99.83
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 99.82
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 99.82
KOG2663309 consensus Acetolactate synthase, small subunit [Am 99.82
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 99.81
KOG1320 473 consensus Serine protease [Posttranslational modif 99.79
CHL00100174 ilvH acetohydroxyacid synthase small subunit 99.79
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 99.74
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 99.54
KOG1421 955 consensus Predicted signaling-associated protein ( 99.44
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 99.43
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 99.32
KOG1320 473 consensus Serine protease [Posttranslational modif 98.92
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 98.74
KOG3627256 consensus Trypsin [Amino acid transport and metabo 98.64
PF00863235 Peptidase_C4: Peptidase family C4 This family belo 98.56
PF05579297 Peptidase_S32: Equine arteritis virus serine endop 97.91
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 97.56
PF05580218 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR 97.43
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 97.43
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 97.42
COG5640 413 Secreted trypsin-like serine protease [Posttransla 97.41
KOG1421 955 consensus Predicted signaling-associated protein ( 97.4
PF10459 698 Peptidase_S46: Peptidase S46; InterPro: IPR019500 97.37
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 97.26
PRK06349426 homoserine dehydrogenase; Provisional 97.22
COG397886 Acetolactate synthase (isozyme II), small (regulat 97.12
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 97.0
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 96.93
PF00548172 Peptidase_C3: 3C cysteine protease (picornain 3C); 96.82
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 96.81
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 96.71
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 96.44
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 96.42
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 96.28
PRK08577136 hypothetical protein; Provisional 96.22
PF10459698 Peptidase_S46: Peptidase S46; InterPro: IPR019500 96.21
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 96.18
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 96.17
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 96.16
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 96.08
PF00949132 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine 96.07
PRK04435147 hypothetical protein; Provisional 96.05
PF08192695 Peptidase_S64: Peptidase family S64; InterPro: IPR 95.97
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 95.28
PF00944158 Peptidase_S3: Alphavirus core protein ; InterPro: 95.27
PF02122203 Peptidase_S39: Peptidase S39; InterPro: IPR000382 94.86
PF09342267 DUF1986: Domain of unknown function (DUF1986); Int 94.77
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 94.77
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 94.45
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 94.35
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 94.28
PF00947127 Pico_P2A: Picornavirus core protein 2A; InterPro: 93.86
PF05416535 Peptidase_C37: Southampton virus-type processing p 93.43
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 93.22
cd0211660 ACT ACT domains are commonly involved in specifica 93.14
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 93.03
PF03510105 Peptidase_C24: 2C endopeptidase (C24) cysteine pro 92.72
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 92.08
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 91.8
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 91.72
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 91.49
PF02395 769 Peptidase_S6: Immunoglobulin A1 protease Serine pr 91.42
PRK0019490 hypothetical protein; Validated 91.09
PF02907148 Peptidase_S29: Hepatitis C virus NS3 protease; Int 91.09
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 90.72
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 90.63
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 90.03
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 89.99
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 89.98
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 89.97
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 89.17
PRK11589190 gcvR glycine cleavage system transcriptional repre 89.07
COG4492150 PheB ACT domain-containing protein [General functi 89.06
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 87.55
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 87.33
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 87.08
cd0493575 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AK 86.65
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 85.72
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 84.71
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 83.91
cd0493473 ACT_AK-Hom3_1 CT domains located C-terminal to the 83.49
cd0487184 ACT_PSP_2 ACT domains found N-terminal of phosphos 82.69
cd0491275 ACT_AKiii-LysC-EC-like_1 ACT domains located C-ter 82.45
COG2150167 Predicted regulator of amino acid metabolism, cont 82.32
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 81.86
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 81.79
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 80.36
COG0317701 SpoT Guanosine polyphosphate pyrophosphohydrolases 80.26
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.2e-36  Score=291.19  Aligned_cols=208  Identities=38%  Similarity=0.616  Sum_probs=170.5

Q ss_pred             HHHHHHHhcCCceEEEEEEeeecCCCCCCCCCCCCCCcCCcccccc--ccccccceeEEEEEEeC-CcEEEEcccccCCC
Q 041421           98 EMIRVFKENIPSVVLIGNLGIRDGNGEGRGGDQSPHTHSRYFAEDQ--SETQFLQASGAGFLWDQ-DGHIVTNHHVICDA  174 (315)
Q Consensus        98 ~~~~~v~~~~~sVV~I~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~GSGfiI~~-~g~VlT~aHvv~~~  174 (315)
                      .++++++++.||||.|.+...... .     ..++..+++||+...  .+.+...+.||||+|++ +||||||+|||.++
T Consensus        41 ~~~~~~~~~~pavV~i~~~~~~~~-~-----~~~~~~~~~~f~~~~~~~~~~~~~~~GSG~ii~~~~g~IlTn~HVv~~a  114 (455)
T PRK10139         41 SLAPMLEKVLPAVVSVRVEGTASQ-G-----QKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIIDAAKGYVLTNNHVINQA  114 (455)
T ss_pred             cHHHHHHHhCCcEEEEEEEEeecc-c-----ccCchhHHHhccccCCccccccccceEEEEEEECCCCEEEeChHHhCCC
Confidence            689999999999999998754331 0     112233445554321  11223457899999985 79999999999999


Q ss_pred             CeEEEEeCCCcEEEEEEEEeCCCCCeEEEEecCCCCCccceEecCCCCCCCCCeEEEEeeCCCCCCceEEeEEeeecccc
Q 041421          175 SKVKVSFSDQSTFYAKVVGHDQDKDLAVLHIDAPNHELRPIHVGVSADLHVGQKICAIGHPLGLPFTCTTGVISALGREI  254 (315)
Q Consensus       175 ~~~~V~~~~g~~~~a~vv~~d~~~DiAll~v~~~~~~~~~l~l~~~~~~~~G~~v~~iG~p~g~~~~~~~g~v~~~~~~~  254 (315)
                      +.+.|++.|++.++|++++.|+.+||||||++. ...+++++|+++..+++|++|+++|||++...+++.|+|++..+..
T Consensus       115 ~~i~V~~~dg~~~~a~vvg~D~~~DlAvlkv~~-~~~l~~~~lg~s~~~~~G~~V~aiG~P~g~~~tvt~GivS~~~r~~  193 (455)
T PRK10139        115 QKISIQLNDGREFDAKLIGSDDQSDIALLQIQN-PSKLTQIAIADSDKLRVGDFAVAVGNPFGLGQTATSGIISALGRSG  193 (455)
T ss_pred             CEEEEEECCCCEEEEEEEEEcCCCCEEEEEecC-CCCCceeEecCccccCCCCEEEEEecCCCCCCceEEEEEccccccc
Confidence            999999999999999999999999999999985 3458899999888999999999999999999999999999987753


Q ss_pred             cCCCCceeecEEEEccCCCCCCccchhccCCCeEEEEEeee--cCCCcceEEEEEcchhhhc
Q 041421          255 PAGTGRLIRGVIQIDASINLGNSGGPLLDSSGSLIGVNTFI--TSGAFTGIGFATPIDTAVL  314 (315)
Q Consensus       255 ~~~~~~~~~~~i~~~~~i~~G~SGGPlvd~~G~vvGI~s~~--~~~~~~~~~~aiP~~~i~~  314 (315)
                      ...  ..+.+++++|+++++|||||||+|.+|+||||+++.  ..+...|+|||||++.++.
T Consensus       194 ~~~--~~~~~~iqtda~in~GnSGGpl~n~~G~vIGi~~~~~~~~~~~~gigfaIP~~~~~~  253 (455)
T PRK10139        194 LNL--EGLENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMART  253 (455)
T ss_pred             cCC--CCcceEEEECCccCCCCCcceEECCCCeEEEEEEEEEcCCCCccceEEEEEhHHHHH
Confidence            211  123568999999999999999999999999999997  3445678999999998875

>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3627 consensus Trypsin [Amino acid transport and metabolism] Back     alignment and domain information
>PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification Back     alignment and domain information
>PF05579 Peptidase_S32: Equine arteritis virus serine endopeptidase S32; InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>PF05580 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR008763 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG3978 Acetolactate synthase (isozyme II), small (regulatory) subunit [Function unknown] Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>PF00944 Peptidase_S3: Alphavirus core protein ; InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF02122 Peptidase_S39: Peptidase S39; InterPro: IPR000382 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PF00947 Pico_P2A: Picornavirus core protein 2A; InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05416 Peptidase_C37: Southampton virus-type processing peptidase; InterPro: IPR001665 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>PF03510 Peptidase_C24: 2C endopeptidase (C24) cysteine protease family; InterPro: IPR000317 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PF02395 Peptidase_S6: Immunoglobulin A1 protease Serine protease Prosite pattern; InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>COG4492 PheB ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04935 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>cd04934 ACT_AK-Hom3_1 CT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae, and other related ACT domains Back     alignment and domain information
>cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04912 ACT_AKiii-LysC-EC-like_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only] Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
3qo6_A 348 Crystal Structure Analysis Of The Plant Protease De 8e-54
1l1j_A239 Crystal Structure Of The Protease Domain Of An Atp- 3e-22
4a8a_A 436 Asymmetric Cryo-Em Reconstruction Of E. Coli Degq 1 4e-22
3stj_A 345 Crystal Structure Of The Protease + Pdz1 Domain Of 5e-22
3sti_A245 Crystal Structure Of The Protease Domain Of Degq Fr 8e-22
1y8t_A 324 Crystal Structure Of Rv0983 From Mycobacterium Tube 1e-21
3otp_A 459 Crystal Structure Of The Degp Dodecamer With A Mode 5e-21
3mh4_A 456 Htra Proteases Are Activated By A Conserved Mechani 5e-21
3mh5_A 456 Htra Proteases Are Activated By A Conserved Mechani 5e-21
4a8d_A 448 Degp Dodecamer With Bound Omp Length = 448 6e-21
2zle_A 448 Cryo-Em Structure Of Degp12OMP Length = 448 6e-21
3mh7_A 456 Htra Proteases Are Activated By A Conserved Mechani 2e-20
3cs0_A 448 Crystal Structure Of Degp24 Length = 448 3e-20
1ky9_A 448 Crystal Structure Of Degp (Htra) Length = 448 3e-20
3pv4_A 354 Structure Of Legionella Fallonii Degq (Delta-Pdz2 V 8e-19
3pv2_A 451 Structure Of Legionella Fallonii Degq (Wt) Length = 9e-19
3pv3_A 451 Structure Of Legionella Fallonii Degq (S193a Varian 9e-19
3lgv_A241 H198p Mutant Of The Degs-Deltapdz Protease Length = 2e-18
3gcn_A 340 Crystal Structure Of Degs H198pD320A MUTANT MODIFIE 3e-18
3lgt_A241 Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease 3e-18
1soz_A 314 Crystal Structure Of Degs Protease In Complex With 3e-18
2qf3_A243 Structure Of The Delta Pdz Truncation Of The Degs P 3e-18
3lgi_A237 Structure Of The Protease Domain Of Degs (Degs-Delt 3e-18
2r3u_A211 Crystal Structure Of The Pdz Deletion Mutant Of Deg 3e-18
2rce_A243 Dfp Modified Degs Delta Pdz Length = 243 3e-18
3lh3_A241 Dfp Modified Degs Delta Pdz Length = 241 4e-18
3lgu_A241 Y162a Mutant Of The Degs-Deltapdz Protease Length = 4e-18
3pv5_A 451 Structure Of Legionella Fallonii Degq (N189gP190G V 6e-18
3lgw_A241 H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease 9e-18
2qf0_A243 Structure Of The Delta Pdz Truncation Of The Degs P 1e-17
1sot_A 320 Crystal Structure Of The Degs Stress Sensor Length 1e-17
1te0_A 318 Structural Analysis Of Degs, A Stress Sensor Of The 1e-17
3b8j_A243 Q191a Mutant Of Degs-Deltapdz Length = 243 2e-17
3lh1_A241 Q191a Mutant Of The Degs-Deltapdz Length = 241 2e-17
2qgr_A243 Structure Of The R178a Mutant Of Delta Pdz Degs Pro 3e-17
3lgy_A241 R178a Mutant Of The Degs-Deltapdz Protease Length = 3e-17
3nzi_A 334 Substrate Induced Remodeling Of The Active Site Reg 7e-17
3num_A 332 Substrate Induced Remodeling Of The Active Site Reg 7e-17
3nwu_A227 Substrate Induced Remodeling Of The Active Site Reg 1e-16
3tjn_A228 Htra1 Catalytic Domain, Apo Form Length = 228 1e-16
3tjo_A231 Htra1 Catalytic Domain, Mutationally Inactivated Le 2e-16
1lcy_A 325 Crystal Structure Of The Mitochondrial Serine Prote 5e-10
4fln_A 539 Crystal Structure Of Plant Protease Deg2 Length = 5 1e-04
>pdb|3QO6|A Chain A, Crystal Structure Analysis Of The Plant Protease Deg1 Length = 348 Back     alignment and structure 
Iteration: 1

 Score =  207 bits (526), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 145/230 (63%), Gaps = 21/230 (9%)
Query: 85  VVTQPCKHQMDELEMIRVFKENIPSVVLIGNLXXXXXXXXXXXXXQSPHTHSRYFAEDQS 144
           VV+ P K Q DEL  +R+F+EN PSVV I NL                      F  D  
Sbjct: 5   VVSTPKKLQTDELATVRLFQENTPSVVYITNLA----------------VRQDAFTLDVL 48
Query: 145 ETQFLQASGAGFLWDQDGHIVTNHHVICDASKVKVSFSDQSTFYAKVVGHDQDKDLAVLH 204
           E    Q SG+GF+WD+ GHIVTN+HVI  AS ++V+ +DQ+TF AKVVG DQDKD+AVL 
Sbjct: 49  EVP--QGSGSGFVWDKQGHIVTNYHVIRGASDLRVTLADQTTFDAKVVGFDQDKDVAVLR 106
Query: 205 IDAPNHELRPIHVGVSADLHVGQKICAIGHPLGLPFTCTTGVISALGREI-PAGTGRLIR 263
           IDAP ++LRPI VGVSADL VGQK+ AIG+P GL  T TTGVIS L REI  A TGR I+
Sbjct: 107 IDAPKNKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLTTGVISGLRREISSAATGRPIQ 166
Query: 264 GVIQIDASINXXXXXXXXXXXXXXXIGVNTFI--TSGAFTGIGFATPIDT 311
            VIQ DA+IN               IG+NT I   SGA +G+GF+ P+DT
Sbjct: 167 DVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGASSGVGFSIPVDT 216
>pdb|1L1J|A Chain A, Crystal Structure Of The Protease Domain Of An Atp- Independent Heat Shock Protease Htra Length = 239 Back     alignment and structure
>pdb|4A8A|A Chain A, Asymmetric Cryo-Em Reconstruction Of E. Coli Degq 12-Mer In Complex With Lysozyme Length = 436 Back     alignment and structure
>pdb|3STJ|A Chain A, Crystal Structure Of The Protease + Pdz1 Domain Of Degq From Escherichia Coli Length = 345 Back     alignment and structure
>pdb|3STI|A Chain A, Crystal Structure Of The Protease Domain Of Degq From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|1Y8T|A Chain A, Crystal Structure Of Rv0983 From Mycobacterium Tuberculosis- Proteolytically Active Form Length = 324 Back     alignment and structure
>pdb|3OTP|A Chain A, Crystal Structure Of The Degp Dodecamer With A Model Substrate Length = 459 Back     alignment and structure
>pdb|3MH4|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|3MH5|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|4A8D|A Chain A, Degp Dodecamer With Bound Omp Length = 448 Back     alignment and structure
>pdb|2ZLE|A Chain A, Cryo-Em Structure Of Degp12OMP Length = 448 Back     alignment and structure
>pdb|3MH7|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|3CS0|A Chain A, Crystal Structure Of Degp24 Length = 448 Back     alignment and structure
>pdb|1KY9|A Chain A, Crystal Structure Of Degp (Htra) Length = 448 Back     alignment and structure
>pdb|3PV4|A Chain A, Structure Of Legionella Fallonii Degq (Delta-Pdz2 Variant) Length = 354 Back     alignment and structure
>pdb|3PV2|A Chain A, Structure Of Legionella Fallonii Degq (Wt) Length = 451 Back     alignment and structure
>pdb|3PV3|A Chain A, Structure Of Legionella Fallonii Degq (S193a Variant) Length = 451 Back     alignment and structure
>pdb|3LGV|A Chain A, H198p Mutant Of The Degs-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|3GCN|A Chain A, Crystal Structure Of Degs H198pD320A MUTANT MODIFIED BY DFP IN Complex With Omp Peptide (Yqf) Length = 340 Back     alignment and structure
>pdb|3LGT|A Chain A, Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|1SOZ|A Chain A, Crystal Structure Of Degs Protease In Complex With An Activating Peptide Length = 314 Back     alignment and structure
>pdb|2QF3|A Chain A, Structure Of The Delta Pdz Truncation Of The Degs Protease Length = 243 Back     alignment and structure
>pdb|3LGI|A Chain A, Structure Of The Protease Domain Of Degs (Degs-Deltapdz) At 1.65 A Length = 237 Back     alignment and structure
>pdb|2R3U|A Chain A, Crystal Structure Of The Pdz Deletion Mutant Of Degs Length = 211 Back     alignment and structure
>pdb|2RCE|A Chain A, Dfp Modified Degs Delta Pdz Length = 243 Back     alignment and structure
>pdb|3LH3|A Chain A, Dfp Modified Degs Delta Pdz Length = 241 Back     alignment and structure
>pdb|3LGU|A Chain A, Y162a Mutant Of The Degs-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|3PV5|A Chain A, Structure Of Legionella Fallonii Degq (N189gP190G VARIANT) Length = 451 Back     alignment and structure
>pdb|3LGW|A Chain A, H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|2QF0|A Chain A, Structure Of The Delta Pdz Truncation Of The Degs Protease Length = 243 Back     alignment and structure
>pdb|1SOT|A Chain A, Crystal Structure Of The Degs Stress Sensor Length = 320 Back     alignment and structure
>pdb|1TE0|A Chain A, Structural Analysis Of Degs, A Stress Sensor Of The Bacterial Periplasm Length = 318 Back     alignment and structure
>pdb|3B8J|A Chain A, Q191a Mutant Of Degs-Deltapdz Length = 243 Back     alignment and structure
>pdb|3LH1|A Chain A, Q191a Mutant Of The Degs-Deltapdz Length = 241 Back     alignment and structure
>pdb|2QGR|A Chain A, Structure Of The R178a Mutant Of Delta Pdz Degs Protease Length = 243 Back     alignment and structure
>pdb|3LGY|A Chain A, R178a Mutant Of The Degs-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|3NZI|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 334 Back     alignment and structure
>pdb|3NUM|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 332 Back     alignment and structure
>pdb|3NWU|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 227 Back     alignment and structure
>pdb|3TJN|A Chain A, Htra1 Catalytic Domain, Apo Form Length = 228 Back     alignment and structure
>pdb|3TJO|A Chain A, Htra1 Catalytic Domain, Mutationally Inactivated Length = 231 Back     alignment and structure
>pdb|1LCY|A Chain A, Crystal Structure Of The Mitochondrial Serine Protease Htra2 Length = 325 Back     alignment and structure
>pdb|4FLN|A Chain A, Crystal Structure Of Plant Protease Deg2 Length = 539 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
3qo6_A 348 Protease DO-like 1, chloroplastic; protease, HTRA, 8e-83
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 7e-59
1y8t_A 324 Hypothetical protein RV0983; serine protease, stru 5e-57
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 4e-56
1lcy_A 325 HTRA2 serine protease; apoptosis, PDZ domain, casp 6e-56
3num_A 332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 2e-55
1te0_A 318 Protease DEGS; two domains, serine protease, PDZ, 8e-55
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 2e-54
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 5e-53
3stj_A 345 Protease DEGQ; serine protease, PDZ domain, protea 2e-52
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 5e-52
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 5e-52
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 7e-52
3k6y_A237 Serine protease, possible membrane-associated seri 1e-50
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 1e-43
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 8e-43
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 1e-38
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 2e-38
2w5e_A163 Putative serine protease; coiled coil, transmembra 3e-33
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 7e-32
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 2e-27
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 3e-24
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 4e-16
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 1e-15
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 2e-15
2pc6_A165 Probable acetolactate synthase isozyme III (small; 2e-15
1hpg_A187 Glutamic acid specific protease; serine protease, 2e-12
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 5e-12
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 2e-10
2o8l_A274 V8 protease, taphylococcal serine; serine protease 2e-10
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 3e-10
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 4e-09
2bhg_A209 Foot-and-mouth disease virus 3C protease; chymotry 4e-09
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 4e-07
2oua_A188 Serine protease, protein NAPA; kinetic stability, 8e-06
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 Back     alignment and structure
 Score =  252 bits (647), Expect = 8e-83
 Identities = 133/235 (56%), Positives = 162/235 (68%), Gaps = 21/235 (8%)

Query: 84  SVVTQPCKHQMDELEMIRVFKENIPSVVLIGNLGIRDGNGEGRGGDQSPHTHSRYFAEDQ 143
            VV+ P K Q DEL  +R+F+EN PSVV I NL +R                   F  D 
Sbjct: 4   FVVSTPKKLQTDELATVRLFQENTPSVVYITNLAVR----------------QDAFTLDV 47

Query: 144 SETQFLQASGAGFLWDQDGHIVTNHHVICDASKVKVSFSDQSTFYAKVVGHDQDKDLAVL 203
            E    Q SG+GF+WD+ GHIVTN+HVI  AS ++V+ +DQ+TF AKVVG DQDKD+AVL
Sbjct: 48  LEVP--QGSGSGFVWDKQGHIVTNYHVIRGASDLRVTLADQTTFDAKVVGFDQDKDVAVL 105

Query: 204 HIDAPNHELRPIHVGVSADLHVGQKICAIGHPLGLPFTCTTGVISALGREIPAG-TGRLI 262
            IDAP ++LRPI VGVSADL VGQK+ AIG+P GL  T TTGVIS L REI +  TGR I
Sbjct: 106 RIDAPKNKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLTTGVISGLRREISSAATGRPI 165

Query: 263 RGVIQIDASINLGNSGGPLLDSSGSLIGVNTFI--TSGAFTGIGFATPIDTAVLV 315
           + VIQ DA+IN GNSGGPLLDSSG+LIG+NT I   SGA +G+GF+ P+DT   +
Sbjct: 166 QDVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGASSGVGFSIPVDTVGGI 220
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Length = 239 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Length = 231 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Length = 237 Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Length = 245 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Length = 237 Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Length = 200 Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Length = 210 Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Length = 242 Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Length = 204 Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Length = 163 Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Length = 246 Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Length = 185 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Length = 213 Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Length = 193 Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Length = 164 Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Length = 165 Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Length = 187 Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Length = 191 Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Length = 181 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Length = 198 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A Length = 209 Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Length = 189 Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Length = 188 Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Length = 186 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query315
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 100.0
3qo6_A 348 Protease DO-like 1, chloroplastic; protease, HTRA, 100.0
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 100.0
3stj_A 345 Protease DEGQ; serine protease, PDZ domain, protea 100.0
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 100.0
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 100.0
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 100.0
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 100.0
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 100.0
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 100.0
3num_A 332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 100.0
3k6y_A237 Serine protease, possible membrane-associated seri 100.0
1te0_A 318 Protease DEGS; two domains, serine protease, PDZ, 100.0
1lcy_A 325 HTRA2 serine protease; apoptosis, PDZ domain, casp 100.0
1y8t_A 324 Hypothetical protein RV0983; serine protease, stru 100.0
2w5e_A163 Putative serine protease; coiled coil, transmembra 99.92
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 99.9
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 99.88
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 99.86
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 99.86
2o8l_A274 V8 protease, taphylococcal serine; serine protease 99.85
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 99.84
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 99.83
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 99.83
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 99.83
2oua_A188 Serine protease, protein NAPA; kinetic stability, 99.83
1hpg_A187 Glutamic acid specific protease; serine protease, 99.81
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 99.8
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 99.79
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 99.78
2pc6_A165 Probable acetolactate synthase isozyme III (small; 99.75
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 99.75
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 99.72
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 99.7
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 99.58
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 99.57
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 99.57
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 99.56
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 99.56
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 99.55
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 99.55
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 99.55
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 99.55
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 99.54
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 99.54
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 99.53
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 99.53
1azz_A226 Collagenase; complex (serine protease/inhibitor), 99.53
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 99.53
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 99.53
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 99.53
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 99.53
1a7s_A225 Heparin binding protein; serine protease homolog, 99.53
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 99.53
1ao5_A237 Glandular kallikrein-13; serine protease, protein 99.53
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 99.53
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 99.52
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 99.52
2xw9_A228 Complement factor D; immune system, hydrolase, ser 99.52
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 99.52
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 99.51
2z7f_E218 Leukocyte elastase; serine protease, serine protea 99.51
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 99.51
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 99.5
1aut_C250 Activated protein C; serine proteinase, plasma cal 99.5
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 99.5
2asu_B234 Hepatocyte growth factor-like protein; serine prot 99.5
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 99.5
1euf_A227 Duodenase; serine protease, dual specificity, hydr 99.49
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 99.49
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 99.49
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 99.49
2aiq_A231 Protein C activator; snake venom serine proteinase 99.49
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 99.49
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 99.49
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 99.49
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 99.48
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 99.48
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 99.48
2r0l_A248 Hepatocyte growth factor activator; serine proteas 99.48
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 99.47
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 99.47
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 99.47
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 99.47
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 99.47
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 99.46
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 99.46
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 99.46
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 99.45
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 99.45
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 99.45
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 99.44
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 99.44
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 99.44
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 99.43
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 99.43
3bg8_A238 Coagulation factor XIA light chain; protease inhib 99.43
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 99.43
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 99.42
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 99.42
2jde_A276 Urokinase-type plasminogen activator; plasminogen 99.42
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 99.42
2qy0_B242 Complement C1R subcomponent; serine protease, beta 99.42
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 99.4
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 99.4
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 99.39
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 99.39
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 99.38
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 99.37
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 99.37
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 99.36
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 99.36
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 99.36
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 99.35
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 99.35
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 99.34
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 99.32
1elv_A333 Complement C1S component; trypsin-like serin prote 99.31
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 99.31
1md8_A329 C1R complement serine protease; innate immunity, a 99.31
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 99.28
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 99.24
1gpz_A399 Complement C1R component; hydrolase, activation, i 99.24
2xxl_A408 GRAM-positive specific serine protease, isoform B; 99.23
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 99.18
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 99.17
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 99.14
2xrc_A565 Human complement factor I; immune system, hydrolas 99.13
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 99.1
3hrz_D741 Complement factor B; serine protease, glycosilated 99.05
2odp_A509 Complement C2; C3/C5 convertase, complement serin 99.04
3mmg_A241 Nuclear inclusion protein A; 3C-type protease, TEV 98.91
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 98.88
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 98.66
1lvm_A229 Catalytic domain of the nuclear inclusion protein 98.56
3qzr_A187 3C protein; chymotrypsin-fold, beta-ribbon, hydrol 97.92
4dcd_A190 Protease 3C, genome polyprotein; antiviral inhibit 97.79
3zve_A190 3C protease; hydrolase, michael inhibitor; HET: G8 97.78
3q3y_A191 HEVB EV93 3C protease; cysteine trypsin-like prote 97.75
2hal_A212 Hepatitis A protease 3C; 3C protease, inhibitor de 97.75
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 97.67
1cqq_A180 Type 2 rhinovirus 3C protease; viral protein, hydr 97.58
2b0f_A182 Picornain 3C (protease 3C) (P3C); beta barrel, hyd 97.57
2bhg_A209 Foot-and-mouth disease virus 3C protease; chymotry 97.43
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 97.23
2ijd_1 644 Picornain 3C, RNA-directed RNA polymerase; RNA-dep 96.53
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 96.39
4ash_A185 NS6 protease; hydrolase, trypsin-like, calicivirus 96.15
2fyq_A194 Chymotrypsin-like cysteine proteinase; protease, n 95.76
2f06_A144 Conserved hypothetical protein; structural genomic 95.72
1y7p_A223 Hypothetical protein AF1403; structural genomics, 95.17
1wxr_A 1048 Haemoglobin protease; hemoglobine protease, autotr 95.09
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 94.94
1u8s_A192 Glycine cleavage system transcriptional repressor, 94.78
4agk_A158 Capsid protein, coat protein, C; hydrolase, viral 94.15
1ep5_B157 Capsid protein C, coat protein C; beta barrel, hyd 94.13
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 94.03
1vcp_A149 Semliki forest virus capsid protein; virus coat pr 93.94
2fom_B185 Polyprotein; flavivirus, NS3 protease, NS2B cofact 93.88
2fp7_B172 Serine protease NS3; flavivirus, NS3 protease, NS2 93.86
2ggv_B185 NS3, non-structural protein 3; beta barrel, serine 93.79
3e90_B198 NS3 protease; trypsin-like serine protease, protea 93.55
3u1j_B191 Serine protease NS3; serine protease, ER MEM hydro 93.53
1svp_A161 Sindbis virus capsid protein; chymotrypsin-like se 93.47
1kxf_A264 Sindbis virus capsid protein; chymotrypsin-like se 93.3
3lkw_A236 Fusion protein of nonstructural protein 2B and non 92.9
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 88.45
3su6_A203 NS3 protease, NS4A protein; drug resistance, drug 86.24
1u8s_A192 Glycine cleavage system transcriptional repressor, 84.32
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=3.3e-38  Score=281.54  Aligned_cols=209  Identities=37%  Similarity=0.605  Sum_probs=150.3

Q ss_pred             hHHHHHHHhcCCceEEEEEEeeecCCCCCCCCCCCCCCcCCccccccc--cccccceeEEEEEEeCC-cEEEEcccccCC
Q 041421           97 LEMIRVFKENIPSVVLIGNLGIRDGNGEGRGGDQSPHTHSRYFAEDQS--ETQFLQASGAGFLWDQD-GHIVTNHHVICD  173 (315)
Q Consensus        97 ~~~~~~v~~~~~sVV~I~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~GSGfiI~~~-g~VlT~aHvv~~  173 (315)
                      .+++++++++.||||+|.+......      ..+++.+++.||+....  +.+...+.||||+|+++ ||||||+||+.+
T Consensus        13 ~~~~~~~~~~~paVV~I~~~~~~~~------~~~~~~~~~~~f~~~~~~~~~~~~~~~GSGfiI~~~~G~IlTnaHvv~~   86 (245)
T 3sti_A           13 PSLAPMLEKVLPAVVSVRVEGTASQ------GQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIINASKGYVLTNNHVINQ   86 (245)
T ss_dssp             CBSHHHHHHHGGGEEEC----------------------------------------CCEEEEEETTTTEEEECGGGC--
T ss_pred             CCHHHHHHHhCCceEEEEEEEeecc------ccccchhhhhhccccccccccccccceEEEEEEeCCCCEEEEcHHHhCC
Confidence            3578999999999999998765430      01234556667764211  12234678999999987 999999999999


Q ss_pred             CCeEEEEeCCCcEEEEEEEEeCCCCCeEEEEecCCCCCccceEecCCCCCCCCCeEEEEeeCCCCCCceEEeEEeeeccc
Q 041421          174 ASKVKVSFSDQSTFYAKVVGHDQDKDLAVLHIDAPNHELRPIHVGVSADLHVGQKICAIGHPLGLPFTCTTGVISALGRE  253 (315)
Q Consensus       174 ~~~~~V~~~~g~~~~a~vv~~d~~~DiAll~v~~~~~~~~~l~l~~~~~~~~G~~v~~iG~p~g~~~~~~~g~v~~~~~~  253 (315)
                      +..+.|.+.+++.++++++..|+.+||||||++. ...+++++|+++..++.|++|+++|||++...+++.|+++...+.
T Consensus        87 a~~i~V~~~dg~~~~a~vv~~d~~~DlAlLkv~~-~~~~~~~~l~~s~~~~~G~~v~aiG~P~g~~~~vt~G~vs~~~~~  165 (245)
T 3sti_A           87 AQKISIQLNDGREFDAKLIGSDDQSDIALLQIQN-PSKLTQIAIADSDKLRVGDFAVAVGNPFGLGQTATSGIVSALGRS  165 (245)
T ss_dssp             --CEEEECTTSCEEEEEEEEEETTTTEEEEEESS-CCSCCCCCBCCGGGCCTTBEEEEEECGGGSCCEEEEEEEEECSSC
T ss_pred             CCEEEEEECCCCEEEEEEEEecCCCCEEEEEecc-CCCCceeeecCcCCCCCCCEEEEEECCCCCCCcEEeeEEeeeccc
Confidence            9999999999999999999999999999999976 346889999877788999999999999999899999999988765


Q ss_pred             ccCCCCceeecEEEEccCCCCCCccchhccCCCeEEEEEeee--cCCCcceEEEEEcchhhhc
Q 041421          254 IPAGTGRLIRGVIQIDASINLGNSGGPLLDSSGSLIGVNTFI--TSGAFTGIGFATPIDTAVL  314 (315)
Q Consensus       254 ~~~~~~~~~~~~i~~~~~i~~G~SGGPlvd~~G~vvGI~s~~--~~~~~~~~~~aiP~~~i~~  314 (315)
                      ..  ......+++++++.+++|+|||||||.+|+||||+++.  ..+...+++||||++.++.
T Consensus       166 ~~--~~~~~~~~i~tda~i~~G~SGGPLvn~~G~vVGI~s~~~~~~~~~~g~~faIP~~~~~~  226 (245)
T 3sti_A          166 GL--NLEGLENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMART  226 (245)
T ss_dssp             SS--CCTTCSSCEEESSCCCTTTTTSEEECTTSCEEEEEECCC------CCCEEEEEHHHHHH
T ss_pred             cc--CCCCccCEEEEcCCcCCCcchhHeecCCCeEEEEEEeEECCCCCcceEEEEEeHHHHHH
Confidence            22  11223567999999999999999999999999999998  3345568999999999875
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A Back     alignment and structure
>3qzr_A 3C protein; chymotrypsin-fold, beta-ribbon, hydrolysis, nucleus, hydrola hydrolase inhibitor complex; HET: AG7; 1.04A {Human enterovirus 71} SCOP: b.47.1.0 PDB: 3osy_A 3qzq_A* 3r0f_A* 3sjo_A* 3sjk_A 3sji_A* 3sj8_A* 3sj9_A Back     alignment and structure
>4dcd_A Protease 3C, genome polyprotein; antiviral inhibitors, dipeptidyl inhib hydrolase-hydrolase inhibitor complex; HET: K36; 1.69A {Human poliovirus 1} PDB: 1l1n_A Back     alignment and structure
>3zve_A 3C protease; hydrolase, michael inhibitor; HET: G84; 1.80A {Human enterovirus} PDB: 3zv8_A* 3zva_A* 3zvb_A* 3zv9_A* 3zvd_A* 3zvc_A* 3zvf_A* 3zvg_A* Back     alignment and structure
>3q3y_A HEVB EV93 3C protease; cysteine trypsin-like protease, 3C cysteine protease (picorn antiviral compound 1 (AG7404); HET: XNV; 1.32A {Human enterovirus B} SCOP: b.47.1.4 PDB: 3q3x_A* 3ruo_A* 3zyd_A 3zz5_A* 3zz6_A* 3zz7_A* 3zz8_A* 3zz9_A* 3zza_A* 3zzb_A* 2ztx_A 2vb0_A 2zty_A 2ztz_A 2zu3_A* 3zye_A 3zz3_A 2zu1_A 3zz4_A 3zzc_A* ... Back     alignment and structure
>2hal_A Hepatitis A protease 3C; 3C protease, inhibitor design; HET: BBL; 1.35A {Hepatitis a virus} SCOP: b.47.1.4 PDB: 2h6m_A* 2h9h_A* 2cxv_A* 2a4o_A* 1hav_A 1qa7_A* Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>1cqq_A Type 2 rhinovirus 3C protease; viral protein, hydrolase; HET: AG7; 1.85A {Human rhinovirus 2} SCOP: b.47.1.4 PDB: 2xya_A* Back     alignment and structure
>2b0f_A Picornain 3C (protease 3C) (P3C); beta barrel, hydrolase-hydrolase inhibitor complex; HET: CA1; NMR {Human rhinovirus 14} PDB: 2in2_A Back     alignment and structure
>2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A Back     alignment and structure
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Back     alignment and structure
>2ijd_1 Picornain 3C, RNA-directed RNA polymerase; RNA-dependent RNA polymerase, picornavirus, protease, hydrolase, transferase; 3.40A {Human poliovirus 1} SCOP: b.47.1.4 e.8.1.4 Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>4ash_A NS6 protease; hydrolase, trypsin-like, calicivirus; 1.58A {Murine norovirus 1} Back     alignment and structure
>2fyq_A Chymotrypsin-like cysteine proteinase; protease, norovirus, calicivirus, viral protein; 1.50A {Norwalk virus} PDB: 2fyr_A 2iph_A* 1wqs_A* Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>4agk_A Capsid protein, coat protein, C; hydrolase, viral protein; 1.81A {Aura virus} PDB: 4agj_A 1kxa_A 2snw_A 1svp_A 1kxb_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A Back     alignment and structure
>1ep5_B Capsid protein C, coat protein C; beta barrel, hydrolase; 2.30A {Venezuelan equine encephalitis virus} SCOP: b.47.1.3 PDB: 1ep6_A 3j0c_C Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Back     alignment and structure
>1vcp_A Semliki forest virus capsid protein; virus coat protein, polyprotein, transmembrane, glycoprotein, nucleocapsid protein, viral protein; 3.00A {Semliki forest virus} SCOP: b.47.1.3 PDB: 1dyl_A 1vcq_A Back     alignment and structure
>2fom_B Polyprotein; flavivirus, NS3 protease, NS2B cofactor, viral protein-prote complex; 1.50A {Dengue virus 2} SCOP: b.47.1.3 PDB: 1df9_A 2qid_A 1bef_A Back     alignment and structure
>2fp7_B Serine protease NS3; flavivirus, NS3 protease, NS2B cofactor; HET: OAR; 1.68A {West nile virus} SCOP: b.47.1.3 Back     alignment and structure
>2ggv_B NS3, non-structural protein 3; beta barrel, serine protease, viral protease, flavivirus, hydrolase; 1.80A {West nile virus} PDB: 2ijo_B Back     alignment and structure
>3e90_B NS3 protease; trypsin-like serine protease, protease inhibitor, catalytic histidine, induced FIT, ATP-binding, capsid protein, helicase; HET: NKK; 2.45A {West nile virus} SCOP: b.47.1.3 Back     alignment and structure
>3u1j_B Serine protease NS3; serine protease, ER MEM hydrolase-hydrolase inhibitor complex; 1.80A {Dengue virus 3} SCOP: b.47.1.3 PDB: 3u1i_B Back     alignment and structure
>1svp_A Sindbis virus capsid protein; chymotrypsin-like serine, mutant, coat protein, viral protein; 2.00A {Sindbis virus} SCOP: b.47.1.3 PDB: 1kxb_A 1kxa_A 2snw_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Back     alignment and structure
>3lkw_A Fusion protein of nonstructural protein 2B and nonstructural protein 3; viral protease, serine protease, NS3 protease, NS2B cofactor; 2.00A {Dengue virus 1} PDB: 3l6p_A Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3su6_A NS3 protease, NS4A protein; drug resistance, drug design, protease inhibitors, serine PR viral protein, hydrolase-inhibitor complex; HET: SU3; 1.10A {Hepatitis c virus} PDB: 3su2_A* 3sv9_A* 3m5l_A* 3m5m_A* 3m5n_A 3m5o_A 3rc4_A 3rc5_A 3rc6_A 3su3_A* 3su4_A* 3sv6_A* 3sv7_A* 3su1_A* 3su5_A* 3sv8_A* 3su0_A* 2p59_A* 2qv1_A 1a1q_A ... Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 315
d1l1ja_228 b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic 4e-31
d2bhga1199 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 1e-30
d2qaaa1185 b.47.1.1 (A:16-242) Protease B {Streptomyces grise 2e-30
d1lcya2205 b.47.1.1 (A:6-210) Mitochondrial serine protease H 2e-30
d2sgaa_181 b.47.1.1 (A:) Protease A {Streptomyces griseus, st 7e-29
d2z9ia2221 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu 5e-28
d1ky9a2249 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata 7e-25
d1qtfa_246 b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus 1e-24
d1agja_242 b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A 3e-23
d2h5ca1198 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobac 1e-22
d1lvmb_219 b.47.1.3 (B:) TEV protease (nucleat inclusion prot 6e-20
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 4e-18
d2qf3a1210 b.47.1.1 (A:43-252) Stress sensor protease DegS, c 3e-17
d2pc6a277 d.58.18.6 (A:1-77) Acetolactate synthase small sub 2e-15
d2fgca278 d.58.18.6 (A:27-104) Acetolactate synthase small s 4e-15
d2f1fa176 d.58.18.6 (A:2-77) Acetolactate synthase small sub 8e-15
d2o8la1216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 1e-13
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 2e-08
d1sc6a384 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogena 9e-08
d2f06a270 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {B 9e-06
d1ygya378 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogena 1e-04
d1y7pa277 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N 1e-04
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 Back     information, alignment and structure

class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Protease Do (DegP, HtrA), catalytic domain
species: Thermotoga maritima [TaxId: 2336]

 Score =  114 bits (286), Expect = 4e-31
 Identities = 76/216 (35%), Positives = 120/216 (55%), Gaps = 6/216 (2%)

Query: 100 IRVFKENIPSVVLIGNLGIRDGNGEGRGGDQSPHTHSRYFAED-QSETQFLQASGAGFLW 158
           + V +   P+VV I  +     +      +Q      ++F E      + + + G+GF++
Sbjct: 7   VNVVEACAPAVVKIDVVKTVKTSFFDPYFEQFFK---KWFGELPPGFERQVASLGSGFIF 63

Query: 159 DQDGHIVTNHHVICDASKVKVSFSDQSTFYAKVVGHDQDKDLAVLHIDAPNHELRPIHVG 218
           D +G+I+TN+HV+  A  + V+  D S + A+ +G D++ D+AV+ I A + +   +  G
Sbjct: 64  DPEGYILTNYHVVGGADNITVTMLDGSKYDAEYIGGDEELDIAVIKIKASDKKFPYLEFG 123

Query: 219 VSADLHVGQKICAIGHPLGLPFTCTTGVISALGREIPAGTGR-LIRGVIQIDASINLGNS 277
            S  + +G+   AIG+PLG   T T GV+SA  R IP   G     G+IQ DA+IN GNS
Sbjct: 124 DSDKVKIGEWAIAIGNPLGFQHTVTVGVVSATNRRIPKPDGSGYYVGLIQTDAAINPGNS 183

Query: 278 GGPLLDSSGSLIGVNTFITS-GAFTGIGFATPIDTA 312
           GGPLL+  G +IG+NT I +      +GFA PI+T 
Sbjct: 184 GGPLLNIHGEVIGINTAIVNPQEAVNLGFAIPINTV 219
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Length = 199 Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 185 Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 181 Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 Back     information, alignment and structure
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Length = 198 Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Length = 219 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Length = 77 Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Length = 78 Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Length = 84 Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 70 Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 78 Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 77 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query315
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 100.0
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 100.0
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 100.0
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 100.0
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.98
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 99.91
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 99.91
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 99.91
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 99.9
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 99.89
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 99.88
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 99.77
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 99.77
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 99.76
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 99.74
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 99.73
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 99.64
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 99.57
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 99.3
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 99.3
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 99.29
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 99.28
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 99.28
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 99.27
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 99.24
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 99.22
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 99.21
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 99.21
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 99.2
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 99.2
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 99.19
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 99.18
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 99.16
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 99.16
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 99.14
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 99.13
d1cqqa_180 3C cysteine protease (picornain 3C) {Human rhinovi 99.11
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 99.11
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.1
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 99.1
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.1
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 99.1
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 99.09
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 99.09
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 99.09
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 99.08
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 99.08
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 99.08
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 99.08
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 99.06
d1elva1259 Complement C1S protease, catalytic domain {Human ( 99.06
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.05
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 99.02
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 99.01
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 99.01
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 98.99
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 98.99
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 98.98
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 98.97
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 98.97
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 98.96
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 98.93
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 98.93
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 98.92
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 98.9
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 98.89
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 98.85
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 98.84
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 98.79
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 98.48
d1l1na_180 3C cysteine protease (picornain 3C) {Human poliovi 98.26
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 98.25
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 98.07
d1mbma_198 NSP4 proteinase {Equine arteritis virus, EAV [TaxI 97.48
d2h6ma1212 3C cysteine protease (picornain 3C) {Human hepatit 97.46
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 97.32
d2fomb1150 NS3 protease {Dengue virus type 2 [TaxId: 11060]} 95.04
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 94.92
d2fp7b1152 NS3 protease {West nile virus [TaxId: 11082]} 94.9
d1ep5a_156 Viral capsid protein {Venezuelan equine encephalit 94.54
d1wyka_152 Viral capsid protein {Sindbis virus [TaxId: 11034] 94.39
d1vcpa_149 Viral capsid protein {Semliki forest virus [TaxId: 94.01
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 92.95
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 91.99
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 90.62
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 87.79
g1dy9.1187 NS3 protease {Human hepatitis C virus (HCV), diffe 86.31
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Protease Do (DegP, HtrA), catalytic domain
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=2.8e-37  Score=274.23  Aligned_cols=209  Identities=38%  Similarity=0.594  Sum_probs=164.6

Q ss_pred             HHHHHHHhcCCceEEEEEEeeecCCCCCCCCCCCCCCcCCccc------------------------cccccccccceeE
Q 041421           98 EMIRVFKENIPSVVLIGNLGIRDGNGEGRGGDQSPHTHSRYFA------------------------EDQSETQFLQASG  153 (315)
Q Consensus        98 ~~~~~v~~~~~sVV~I~~~~~~~~~~~~~~~~~~~~~~~~~~~------------------------~~~~~~~~~~~~G  153 (315)
                      +++++++++.||||.|.+.........     +.|..+..+|.                        ....+.+...+.|
T Consensus         4 s~a~~ve~v~PaVV~I~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~G   78 (249)
T d1ky9a2           4 SLAPMLEKVMPSVVSINVEGSTTVNTP-----RMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALG   78 (249)
T ss_dssp             CSHHHHHHHGGGEEEEEEEEEEEECCC-----CSSCCTTCCCC---------------------------CEEEEEEEEE
T ss_pred             ChHHHHHHhCCceEEEEEEEEEeecCC-----cCcchhhhccccCCcccccccccccccccccccccccccccccccccc
Confidence            467899999999999988654431111     11111111111                        0111223456789


Q ss_pred             EEEEEeCC-cEEEEcccccCCCCeEEEEeCCCcEEEEEEEEeCCCCCeEEEEecCCCCCccceEecCCCCCCCCCeEEEE
Q 041421          154 AGFLWDQD-GHIVTNHHVICDASKVKVSFSDQSTFYAKVVGHDQDKDLAVLHIDAPNHELRPIHVGVSADLHVGQKICAI  232 (315)
Q Consensus       154 SGfiI~~~-g~VlT~aHvv~~~~~~~V~~~~g~~~~a~vv~~d~~~DiAll~v~~~~~~~~~l~l~~~~~~~~G~~v~~i  232 (315)
                      |||+|+++ ||||||+||+.+++.+.+.+.+++.+.++++..|+..|+|+|+++. ...+++++|+++..++.|++|+++
T Consensus        79 SG~iI~~~~g~IlTn~HVv~~~~~~~v~~~~~~~~~a~~~~~d~~~dlavl~i~~-~~~~~~~~l~~~~~~~~G~~v~ai  157 (249)
T d1ky9a2          79 SGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQN-PKNLTAIKMADSDALRVGDYTVAI  157 (249)
T ss_dssp             EEEEEETTTTEEEEEHHHHTTEEEEEEEETTSCEEEEEEEEEETTTTEEEEEESS-CCSCCCCCBCCGGGCCTTCEEEEE
T ss_pred             cEEEEeccCceEEeeccccccceeeeeeecccccccceeeEeccchhhceeeecc-cccceEEEcCCcCcCCcCCEEEEE
Confidence            99999865 8999999999999999999999999999999999999999999986 346889999888889999999999


Q ss_pred             eeCCCCCCceEEeEEeeecccccCCCCceeecEEEEccCCCCCCccchhccCCCeEEEEEeee--cCCCcceEEEEEcch
Q 041421          233 GHPLGLPFTCTTGVISALGREIPAGTGRLIRGVIQIDASINLGNSGGPLLDSSGSLIGVNTFI--TSGAFTGIGFATPID  310 (315)
Q Consensus       233 G~p~g~~~~~~~g~v~~~~~~~~~~~~~~~~~~i~~~~~i~~G~SGGPlvd~~G~vvGI~s~~--~~~~~~~~~~aiP~~  310 (315)
                      |||++...+++.+.++...+...  ......++|++|+.+.+|||||||+|.+|+||||+++.  ..+...+++||||++
T Consensus       158 G~P~g~~~tvt~~~~~~~~~~~~--~~~~~~~~iqtda~i~~GnSGGPl~n~~G~vIGI~t~~~~~~~~~~gi~faIP~~  235 (249)
T d1ky9a2         158 GNPFGLGETVTSGIVSALGRSGL--NAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSN  235 (249)
T ss_dssp             ECTTSSSCEEEEEEEEEESSCC-------CCCCEEESCCCTTSCCCSEEECTTSCEEEEEECSSTTSCCCSSSEEEEEHH
T ss_pred             ecccccCCceeecceeecccccc--cCccccceEEEeeeecCCCCCceEECCCCEEEEEEEEEeccCCCcccEEEEEEHH
Confidence            99999999999999888866433  12234568999999999999999999999999999998  444567899999999


Q ss_pred             hhhc
Q 041421          311 TAVL  314 (315)
Q Consensus       311 ~i~~  314 (315)
                      .++.
T Consensus       236 ~~~~  239 (249)
T d1ky9a2         236 MVKN  239 (249)
T ss_dssp             HHHH
T ss_pred             HHHH
Confidence            8875
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mbma_ b.47.1.3 (A:) NSP4 proteinase {Equine arteritis virus, EAV [TaxId: 11047]} Back     information, alignment and structure
>d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fomb1 b.47.1.3 (B:18-167) NS3 protease {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West nile virus [TaxId: 11082]} Back     information, alignment and structure
>d1ep5a_ b.47.1.3 (A:) Viral capsid protein {Venezuelan equine encephalitis virus [TaxId: 11036]} Back     information, alignment and structure
>d1wyka_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]} Back     information, alignment and structure
>d1vcpa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus [TaxId: 11033]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure