Citrus Sinensis ID: 041442


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MNDADVSRQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKMQLFEAEKKKIKQEYERKSKQAEARRKIEYSMQLNAARIKFLQAQDDAVNAMKEAASKELLNVSNDKNKYRTVLKGLIVQSMLRLNEKAVLLRCREMDRKLVESIVEEAKKEFAEKTKRQAPKITMDDKVFLPPPPKSADSHEPSCSGGVVVASQDGKIVLENTLDARLNVAFRQNLPEIRKRLLGKVGV
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHHHHccccccEEccccccccccccccccccccccccEEEEcccccEEEcccHHHHHHHHHHHcHHHHHHHHcccccc
*******RQIQQMVRFIRQEAEEKANEISVSAE*EFNIEKMQLFEA***************************LNAARIKFLQAQDDAVNAMKEAAS****NV*NDKNKYRTVLKGLIVQSMLRLNEKAVLLRCREMDRKLVESIVEEAKKEFAEKTKRQAPKITMDDKVFLPPPPKS****EPSCSGGVVVASQDGKIVLENTLDARLNVAFRQNLPEIRKRLLGKVG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDADVSRQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKxxxxxxxxxxxxxxxxxxxxxxxxxRKIEYSMQLNAARIKFLQAQDDAVNAMKEAASKELLNVSNDKNKYRTVLKGLIVQSMLRLNEKAVLLRCREMDRKLVESIVEEAKKEFAEKTKRQAPKITMDDKVFLPPPPKSADSHEPSCSGGVVVASQDGKIVLENTLDARLNVAFRQNLPEIRKRLLGKVGV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
V-type proton ATPase subunit E1 Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Required for Golgi organization and vacuole function in embryogenesis.confidentQ39258
V-type proton ATPase subunit E Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.probableQ9SWE7
V-type proton ATPase subunit E Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.probableQ40272

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EFA, chain E
Confidence level:very confident
Coverage over the Query: 1-228
View the alignment between query and template
View the model in PyMOL