Citrus Sinensis ID: 041460


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--
MGLSQFLGFFVFLLLSRVIAAATKSDVKFDQNYYITWGNDHVLSLNQGRAIQLSMDRSSGSGFGSKLHYGSGFFHLKMKLPDKDSAGIVTAFYLTSQGDKHDELDFEFLGNREGKPITLQTNVFANGVGNREQRMHLWFDPTADFHTYKILWNPHQIVFYVDDVPIRVFKNLESIGVGYPSKPMQIEASLWNGESWATDGGRTKIDWTHAPFKAHFQGFDISGCPADDDQNRSIQRCYSSQYWWNSEKFWKLHSTQKAKYEN
ccHHHHHHHHHHHHHHHHHHcccccccccccccEEEEccccEEEcccccEEEEEEccccccCEEECcCEEEEEEEEEEEEccccccCEEEEEEECccccccccEEEEECccccccccEEEEEEEEcccccCEEEEEcccccccccEEEEEEEcccEEEEEEccEEEEEEEccccccccccccccEEEEEECccccccccccCEECccccccEEEEEEEEEECcccccccccccccccccccccccccccccccHHHHHHHcc
****QFLGFFVFLLLSRVIAAATKSDVKFDQNYYITWGNDHVLSLNQGRAIQLSMDRSSGSGFGSKLHYGSGFFHLKMKLPDKDSAGIVTAFYLTSQGDKHDELDFEFLGNREGKPITLQTNVFANGVGNREQRMHLWFDPTADFHTYKILWNPHQIVFYVDDVPIRVFKNLESIGVGYPSKPMQIEASLWNGESWATDGGRTKIDWTHAPFKAHFQGFDISGCPADDDQNRS********YWWNSEKFWKLHST****YE*
xxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLSQFLGFFVFLLLSRVIAAATKSDVKFDQNYYITWGNDHVLSLNQGRAIQLSMDRSSGSGFGSKLHYGSGFFHLKMKLPDKDSAGIVTAFYLTSQGDKHDELDFEFLGNREGKPITLQTNVFANGVGNREQRMHLWFDPTADFHTYKILWNPHQIVFYVDDVPIRVFKNLESIGVGYPSKPMQIEASLWNGESWATDGGRTKIDWTHAPFKAHFQGFDISGCPADDDQNRSIQRCYSSQYWWNSEKFWKLHSTQKAKYEN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Xyloglucan endotransglucosylase/hydrolase protein 2 May catalyze xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.probableQ9SV60
Probable xyloglucan endotransglucosylase/hydrolase Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.probableQ41542

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UMZ, chain A
Confidence level:very confident
Coverage over the Query: 26-262
View the alignment between query and template
View the model in PyMOL
Template: 2VH9, chain A
Confidence level:confident
Coverage over the Query: 24-224
View the alignment between query and template
View the model in PyMOL