Citrus Sinensis ID: 041487


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
SNFSLQIHDLFRTNMKKVKDCCYKVVKKTNGSEQMEKVKDWNYKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKELEHDNIVRLLDVLTTGRYVYLVFEYLDLDLGSFIRKHTITSIRPHIKEVGSPYKAPESRIRSSVYSTPHDVWAVGCIFAEMVSGKPLFPCGKKDHLSLIVRYFTALTNYLVLPCFLSIMLLT
ccccccccHHHHHHccccccccccccccccccHHHccccccccEEEEEEcccccEEEEEEEEcccccEEEEEEEEcccccccccHHHHHHHHHHHcccccccccEEEEEEEccEEEEEccccccHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccHHHEEEEEEEEEEccEEEEEEEEcccccEEEEEEEEcccccccccHHHHHHHHHHHHcccccEccEEEEEEcccEEEEEEEcccEEHHHHHccccccccHHHHHHccccHcccHHHHcEcccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccccccccccc
SNFSLQIHDLFRTNMKKVKDCCYKVVkktngseqmekVKDWNYKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINiqnepegvpsYLIAGVSLLKELEHDNIVRLLDVLTTGRYVYLVFEYLDldlgsfirkhtitsirphikevgspykapesrirssvystphdvwAVGCIFAemvsgkplfpcgkkdhLSLIVRYFTALTNYLVLPCFLSIMLLT
snfslqihdlfrtnmkkvkdcCYKVVkktngseqmekvkdWNYKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKELEHDNIVRLLDVLTTGRYVYLVFEYLDLDLGSFIRKHTitsirphikevgspykapesrIRSSVYSTPHDVWAVGCIFAEMVSGKPLFPCGKKDHLSLIVRYFTALTNYLVLPCFLSIMLLT
SNFSLQIHDLFRTNMkkvkdccykvvkkTNGSEQMEKVKDWNYKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKELEHDNIVRLLDVLTTGRYVYLVFEYLDLDLGSFIRKHTITSIRPHIKEVGSPYKAPESRIRSSVYSTPHDVWAVGCIFAEMVSGKPLFPCGKKDHLSLIVRYFTALTNYLVLPCFLSIMLLT
****LQIHDLFRTNMKKVKDCCYKVVKKTNGSEQMEKVKDWNYKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKELEHDNIVRLLDVLTTGRYVYLVFEYLDLDLGSFIRKHTITSIRPHIKEVG*********IRSSVYSTPHDVWAVGCIFAEMVSGKPLFPCGKKDHLSLIVRYFTALTNYLVLPCFLSIMLL*
******************************************YKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKELEHDNIVRLLDVLTTGRYVYLVFEYLDLDLGSFIRKHTITSIRPHIKEVGSPYKAPESRIRSSVYSTPHDVWAVGCIFAEMVSGKPLFPCGKKDHLSLIVRYFTALTNYLVLPCFLSIMLLT
SNFSLQIHDLFRTNMKKVKDCCYKVVKKTNGSEQMEKVKDWNYKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKELEHDNIVRLLDVLTTGRYVYLVFEYLDLDLGSFIRKHTITSIRPHIKEVGSPYKAPESRIRSSVYSTPHDVWAVGCIFAEMVSGKPLFPCGKKDHLSLIVRYFTALTNYLVLPCFLSIMLLT
**************************************KDWNYKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKELEHDNIVRLLDVLTTGRYVYLVFEYLDLDLGSFIRKHTITSIRPHIKEVGSPYKAPESRIRSSVYSTPHDVWAVGCIFAEMVSGKPLFPCGKKDHLSLIVRYFTALTNYLVLPCFLSI*LL*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SNFSLQIHDLFRTNMKKVKDCCYKVVKKTNGSEQMEKVKDWNYKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKELEHDNIVRLLDVLTTGRYVYLVFEYLDLDLGSFIRKHTITSIRPHIKEVGSPYKAPESRIRSSVYSTPHDVWAVGCIFAEMVSGKPLFPCGKKDHLSLIVRYFTALTNYLVLPCFLSIMLLT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query218 2.2.26 [Sep-21-2011]
P34117292 Cyclin-dependent kinase 5 yes no 0.711 0.530 0.394 2e-28
Q00526305 Cyclin-dependent kinase 3 no no 0.711 0.508 0.392 2e-26
P23437297 Cyclin-dependent kinase 2 N/A no 0.715 0.525 0.339 1e-23
Q80YP0303 Cyclin-dependent kinase 3 yes no 0.706 0.508 0.350 9e-22
P00546298 Cyclin-dependent kinase 1 yes no 0.655 0.479 0.344 1e-21
P24033302 Cyclin-dependent kinase 1 N/A no 0.743 0.536 0.351 5e-21
P43063317 Cyclin-dependent kinase 1 N/A no 0.729 0.501 0.328 6e-21
Q9DGD3303 Cyclin-dependent kinase 1 N/A no 0.747 0.537 0.331 1e-20
Q9DGA2303 Cyclin-dependent kinase 1 N/A no 0.747 0.537 0.331 1e-20
Q9DG98303 Cyclin-dependent kinase 1 N/A no 0.747 0.537 0.331 1e-20
>sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 Back     alignment and function desciption
 Score =  125 bits (314), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 106/213 (49%), Gaps = 58/213 (27%)

Query: 43  YKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKELEHDNI 102
           Y  +EK+G+G +G VYK  N ETG+ VA+K I + +E EGVP   I  +SLLKEL+H NI
Sbjct: 4   YSKIEKLGEGTYGIVYKAKNRETGEIVALKRIRLDSEDEGVPCTAIREISLLKELKHPNI 63

Query: 103 VRLLDVLTTGRYVYLVFEYLDLDL-------GSFIRKHTITS------------------ 137
           VRL DV+ T R + LVFEYLD DL       G  I K TI S                  
Sbjct: 64  VRLHDVIHTERKLTLVFEYLDQDLKKYLDECGGEISKPTIKSFMYQLLKGVAFCHDHRVL 123

Query: 138 ---IRPH-----------------IKEVGSP------------YKAPESRIRSSVYSTPH 165
              ++P                   +  G P            Y+AP+  + S  YSTP 
Sbjct: 124 HRDLKPQNLLINRKGELKLADFGLARAFGIPVRTYSHEVVTLWYRAPDVLMGSRKYSTPI 183

Query: 166 DVWAVGCIFAEMVSGKPLFP-CGKKDHLSLIVR 197
           D+W+ GCIFAEM SG+PLFP  G  D L  I +
Sbjct: 184 DIWSAGCIFAEMASGRPLFPGSGTSDQLFRIFK 216





Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 2EC: 2
>sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 Back     alignment and function description
>sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 Back     alignment and function description
>sp|Q80YP0|CDK3_MOUSE Cyclin-dependent kinase 3 OS=Mus musculus GN=Cdk3 PE=1 SV=2 Back     alignment and function description
>sp|P00546|CDK1_YEAST Cyclin-dependent kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC28 PE=1 SV=1 Back     alignment and function description
>sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 Back     alignment and function description
>sp|P43063|CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=2 SV=1 Back     alignment and function description
>sp|Q9DGD3|CDK1_ORYLA Cyclin-dependent kinase 1 OS=Oryzias latipes GN=cdk1 PE=2 SV=1 Back     alignment and function description
>sp|Q9DGA2|CDK1_ORYJA Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1 Back     alignment and function description
>sp|Q9DG98|CDK1_ORYLU Cyclin-dependent kinase 1 OS=Oryzias luzonensis GN=cdk1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
334323158248 PREDICTED: cyclin-dependent kinase 3-lik 0.711 0.625 0.484 2e-30
194037512241 PREDICTED: cyclin-dependent kinase 2 iso 0.715 0.647 0.5 2e-30
348508000241 PREDICTED: cyclin-dependent kinase 2-lik 0.715 0.647 0.481 1e-29
291235181243 PREDICTED: cell division cycle 2-like is 0.655 0.588 0.482 9e-28
403297079 351 PREDICTED: cyclin-dependent kinase 2 [Sa 0.715 0.444 0.448 7e-27
330840804292 protein serine/threonine kinase [Dictyos 0.711 0.530 0.394 9e-27
340717613241 PREDICTED: cyclin-dependent kinase 1-lik 0.715 0.647 0.446 1e-26
327264997 325 PREDICTED: cyclin-dependent kinase 3-lik 0.834 0.56 0.366 1e-26
380030750241 PREDICTED: cyclin-dependent kinase 1-lik 0.743 0.672 0.436 1e-26
66805759292 protein serine/threonine kinase [Dictyos 0.711 0.530 0.394 1e-26
>gi|334323158|ref|XP_003340355.1| PREDICTED: cyclin-dependent kinase 3-like isoform 2 [Monodelphis domestica] Back     alignment and taxonomy information
 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 103/157 (65%), Gaps = 2/157 (1%)

Query: 43  YKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKELEHDNI 102
           ++ VEKIG+G +G VYK  N +TG+ VA+K I + +E EGVPS  I  +SLLKEL+H NI
Sbjct: 4   FQKVEKIGEGTYGVVYKARNKQTGQLVALKKIRLDSETEGVPSTAIREISLLKELKHPNI 63

Query: 103 VRLLDVLTTGRYVYLVFEYLDLDLGSFIRKHTITSIRPH-IKEVGSPYKAPESRIRSSVY 161
           VRLLDV+ + + +YLVFE+L  DL  ++     T +  H +K V   Y+APE  +    Y
Sbjct: 64  VRLLDVVHSEKKLYLVFEFLSQDLKKYMDSAAATELPLHLVKVVTLWYRAPEILLGCKFY 123

Query: 162 STPHDVWAVGCIFAEMVSGKPLFPCGKK-DHLSLIVR 197
           ST  DVW++GCIFAEMV+ + LFP   + D L  I R
Sbjct: 124 STAVDVWSIGCIFAEMVTRRALFPGDSEIDQLFRIFR 160




Source: Monodelphis domestica

Species: Monodelphis domestica

Genus: Monodelphis

Family: Didelphidae

Order: Didelphimorphia

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|194037512|ref|XP_001929000.1| PREDICTED: cyclin-dependent kinase 2 isoform 2 [Sus scrofa] Back     alignment and taxonomy information
>gi|348508000|ref|XP_003441543.1| PREDICTED: cyclin-dependent kinase 2-like isoform 2 [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|291235181|ref|XP_002737516.1| PREDICTED: cell division cycle 2-like isoform 2 [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|403297079|ref|XP_003939416.1| PREDICTED: cyclin-dependent kinase 2 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|330840804|ref|XP_003292399.1| protein serine/threonine kinase [Dictyostelium purpureum] gi|325077355|gb|EGC31073.1| protein serine/threonine kinase [Dictyostelium purpureum] Back     alignment and taxonomy information
>gi|340717613|ref|XP_003397275.1| PREDICTED: cyclin-dependent kinase 1-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|327264997|ref|XP_003217295.1| PREDICTED: cyclin-dependent kinase 3-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|380030750|ref|XP_003699005.1| PREDICTED: cyclin-dependent kinase 1-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|66805759|ref|XP_636601.1| protein serine/threonine kinase [Dictyostelium discoideum AX4] gi|161784321|sp|P34117.2|CDK5_DICDI RecName: Full=Cyclin-dependent kinase 5 homolog; AltName: Full=CDC2-like serine/threonine-protein kinase CRP; AltName: Full=Cell division protein kinase 5 gi|60464959|gb|EAL63070.1| protein serine/threonine kinase [Dictyostelium discoideum AX4] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
DICTYBASE|DDB_G0288677 292 cdk5 "cyclin-dependent kinase 0.463 0.345 0.504 3.8e-33
TAIR|locus:2099478 294 CDC2 "cell division control 2" 0.385 0.285 0.535 1.3e-32
UNIPROTKB|P29618 294 CDKA-1 "Cyclin-dependent kinas 0.403 0.299 0.511 4.3e-32
UNIPROTKB|P23437 297 cdk2 "Cyclin-dependent kinase 0.444 0.326 0.536 6.9e-32
UNIPROTKB|E2QW70 298 CDK2 "Uncharacterized protein" 0.467 0.342 0.524 6.9e-32
UNIPROTKB|F1SPH6 298 CDK2 "Uncharacterized protein" 0.467 0.342 0.524 6.9e-32
UNIPROTKB|O55076 298 CDK2 "Cyclin-dependent kinase 0.467 0.342 0.524 6.9e-32
UNIPROTKB|Q5E9Y0 298 CDK2 "Cyclin-dependent kinase 0.467 0.342 0.524 8.8e-32
UNIPROTKB|P24941 298 CDK2 "Cyclin-dependent kinase 0.467 0.342 0.524 8.8e-32
UNIPROTKB|A0MSV8 298 cdk2 "Cyclin-dependent kinase 0.467 0.342 0.524 8.8e-32
DICTYBASE|DDB_G0288677 cdk5 "cyclin-dependent kinase 5" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
 Score = 236 (88.1 bits), Expect = 3.8e-33, Sum P(2) = 3.8e-33
 Identities = 51/101 (50%), Positives = 67/101 (66%)

Query:    43 YKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKELEHDNI 102
             Y  +EK+G+G +G VYK  N ETG+ VA+K I + +E EGVP   I  +SLLKEL+H NI
Sbjct:     4 YSKIEKLGEGTYGIVYKAKNRETGEIVALKRIRLDSEDEGVPCTAIREISLLKELKHPNI 63

Query:   103 VRLLDVLTTGRYVYLVFEYLDLDLGSFIRKHTITSIRPHIK 143
             VRL DV+ T R + LVFEYLD DL  ++ +      +P IK
Sbjct:    64 VRLHDVIHTERKLTLVFEYLDQDLKKYLDECGGEISKPTIK 104


GO:0031157 "regulation of aggregate size involved in sorocarp development" evidence=IMP
GO:0031152 "aggregation involved in sorocarp development" evidence=IMP
GO:0030435 "sporulation resulting in formation of a cellular spore" evidence=IMP
GO:0008283 "cell proliferation" evidence=IMP
GO:0006909 "phagocytosis" evidence=IMP
GO:0006907 "pinocytosis" evidence=IMP
GO:0007049 "cell cycle" evidence=IEA;IDA
GO:0006468 "protein phosphorylation" evidence=IEA;IDA
GO:0005622 "intracellular" evidence=IDA
GO:0004693 "cyclin-dependent protein serine/threonine kinase activity" evidence=IEA;IDA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0004672 "protein kinase activity" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
GO:0016310 "phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0072686 "mitotic spindle" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005654 "nucleoplasm" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0005516 "calmodulin binding" evidence=IPI
GO:0044351 "macropinocytosis" evidence=RCA
TAIR|locus:2099478 CDC2 "cell division control 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P29618 CDKA-1 "Cyclin-dependent kinase A-1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P23437 cdk2 "Cyclin-dependent kinase 2" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|E2QW70 CDK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SPH6 CDK2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O55076 CDK2 "Cyclin-dependent kinase 2" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E9Y0 CDK2 "Cyclin-dependent kinase 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P24941 CDK2 "Cyclin-dependent kinase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A0MSV8 cdk2 "Cyclin-dependent kinase 2" [Capra hircus (taxid:9925)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.11LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 2e-45
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 3e-37
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 1e-36
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 6e-35
pfam00069260 pfam00069, Pkinase, Protein kinase domain 2e-34
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 2e-34
cd07835 283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 4e-32
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 1e-30
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 6e-28
PLN00009 294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 7e-27
cd07840 287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 2e-25
cd07838 287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 1e-24
cd07839 284 cd07839, STKc_CDK5, Catalytic domain of the Serine 2e-24
cd07836 284 cd07836, STKc_Pho85, Catalytic domain of the Serin 3e-24
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 3e-24
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 3e-23
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 3e-23
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 5e-23
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 2e-22
cd07837 295 cd07837, STKc_CdkB_plant, Catalytic domain of the 1e-21
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 2e-21
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 5e-21
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 6e-21
cd07832 286 cd07832, STKc_CCRK, Catalytic domain of the Serine 1e-20
cd07865 310 cd07865, STKc_CDK9, Catalytic domain of the Serine 4e-20
cd07866 311 cd07866, STKc_BUR1, Catalytic domain of the Serine 9e-20
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 4e-19
cd07844 291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 6e-19
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 1e-18
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 4e-18
cd07863 288 cd07863, STKc_CDK4, Catalytic domain of the Serine 1e-17
cd07864 302 cd07864, STKc_CDK12, Catalytic domain of the Serin 3e-17
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 5e-17
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-16
cd07862 290 cd07862, STKc_CDK6, Catalytic domain of the Serine 3e-16
cd07830 283 cd07830, STKc_MAK_like, Catalytic domain of Male g 4e-16
cd07852 337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 2e-15
cd07834 330 cd07834, STKc_MAPK, Catalytic domain of the Serine 2e-15
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 4e-15
cd07870 291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 7e-15
cd07845 309 cd07845, STKc_CDK10, Catalytic domain of the Serin 8e-15
cd07842 316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 1e-14
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 3e-14
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 4e-14
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 1e-13
cd07847 286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 1e-13
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 4e-13
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 5e-13
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 1e-12
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 1e-12
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 1e-12
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 3e-12
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 3e-12
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 4e-12
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 5e-12
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 5e-12
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 2e-11
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 2e-11
cd06656 297 cd06656, STKc_PAK3, Catalytic domain of the Protei 2e-11
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 2e-11
cd07855 334 cd07855, STKc_ERK5, Catalytic domain of the Serine 2e-11
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 4e-11
cd06655 296 cd06655, STKc_PAK2, Catalytic domain of the Protei 4e-11
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 5e-11
cd06654 296 cd06654, STKc_PAK1, Catalytic domain of the Protei 1e-10
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 2e-10
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 2e-10
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-10
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 2e-10
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 3e-10
PTZ00024 335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 4e-10
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 5e-10
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 6e-10
cd07848 287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 6e-10
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 8e-10
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 8e-10
cd07851 343 cd07851, STKc_p38, Catalytic domain of the Serine/ 1e-09
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 2e-09
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 3e-09
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 3e-09
cd07858 337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 4e-09
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 4e-09
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 4e-09
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 5e-09
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 9e-09
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 1e-08
cd07849 336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 1e-08
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 1e-08
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 1e-08
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 1e-08
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 2e-08
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 2e-08
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 2e-08
cd07859 338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 3e-08
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 4e-08
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 4e-08
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 5e-08
cd05600 333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 6e-08
cd07879 342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 6e-08
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 8e-08
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 8e-08
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 8e-08
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 8e-08
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 1e-07
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 1e-07
cd06643 282 cd06643, STKc_SLK, Catalytic domain of the Protein 1e-07
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 1e-07
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 2e-07
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 2e-07
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 2e-07
cd07867 317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 2e-07
cd07867317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 2e-07
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 2e-07
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 2e-07
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 2e-07
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 2e-07
cd07868317 cd07868, STKc_CDK8, Catalytic domain of the Serine 3e-07
cd07853 372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 3e-07
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 3e-07
cd07854 342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 4e-07
cd07850 353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 4e-07
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 4e-07
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 4e-07
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 4e-07
cd05050 288 cd05050, PTKc_Musk, Catalytic domain of the Protei 4e-07
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 4e-07
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 5e-07
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 5e-07
cd07868 317 cd07868, STKc_CDK8, Catalytic domain of the Serine 9e-07
cd06644 292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 9e-07
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 1e-06
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 1e-06
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 1e-06
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 1e-06
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 1e-06
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 2e-06
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 2e-06
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 3e-06
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 3e-06
cd07876 359 cd07876, STKc_JNK2, Catalytic domain of the Serine 3e-06
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 4e-06
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 5e-06
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 5e-06
PTZ00036 440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 5e-06
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 6e-06
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 7e-06
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 8e-06
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 9e-06
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 1e-05
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 1e-05
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 1e-05
cd07856 328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 2e-05
cd05093 288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 2e-05
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 2e-05
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 2e-05
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 2e-05
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 2e-05
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 3e-05
cd05094 291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 3e-05
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 3e-05
cd07874 355 cd07874, STKc_JNK3, Catalytic domain of the Serine 3e-05
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 3e-05
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 3e-05
cd05580 290 cd05580, STKc_PKA, Catalytic domain of the Protein 3e-05
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 4e-05
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 5e-05
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 7e-05
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 9e-05
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 1e-04
cd07857 332 cd07857, STKc_MPK1, Catalytic domain of the Serine 1e-04
cd07853 372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 1e-04
PTZ00036 440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 1e-04
cd07878 343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 1e-04
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 1e-04
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 1e-04
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 2e-04
PLN00034 353 PLN00034, PLN00034, mitogen-activated protein kina 2e-04
cd07875 364 cd07875, STKc_JNK1, Catalytic domain of the Serine 2e-04
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 2e-04
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 2e-04
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 2e-04
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 2e-04
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 2e-04
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 3e-04
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 3e-04
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 4e-04
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 4e-04
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 4e-04
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 5e-04
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 5e-04
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 6e-04
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 7e-04
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 7e-04
cd05106 374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 7e-04
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 7e-04
cd07850 353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 8e-04
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 8e-04
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 8e-04
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 0.001
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 0.001
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 0.001
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 0.001
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 0.001
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 0.001
cd05096 304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 0.001
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 0.001
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 0.002
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 0.002
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 0.002
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 0.002
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 0.002
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 0.002
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 0.002
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 0.002
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 0.003
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 0.003
PHA03210 501 PHA03210, PHA03210, serine/threonine kinase US3; P 0.003
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 0.003
cd05599 364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 0.003
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 0.003
cd05045 290 cd05045, PTKc_RET, Catalytic domain of the Protein 0.003
PHA03209 357 PHA03209, PHA03209, serine/threonine kinase US3; P 0.003
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 0.004
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 0.004
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 0.004
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
 Score =  152 bits (386), Expect = 2e-45
 Identities = 76/215 (35%), Positives = 104/215 (48%), Gaps = 58/215 (26%)

Query: 43  YKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKELEHDNI 102
           Y+ +EK+G+G +G VYK  + +TG+ VA+K I + NE EG+PS  +  +SLLKEL+H NI
Sbjct: 1   YEKLEKLGEGTYGVVYKARDKKTGEIVALKKIRLDNEEEGIPSTALREISLLKELKHPNI 60

Query: 103 VRLLDVLTTGRYVYLVFEYLDLDLGSFIRKHTITSIRPHIK------------------- 143
           V+LLDV+ T R +YLVFEY D+DL  ++ K         IK                   
Sbjct: 61  VKLLDVIHTERKLYLVFEYCDMDLKKYLDKRPGPLSPNLIKSIMYQLLRGLAYCHSHRIL 120

Query: 144 --------------------------EVGSPYKA------------PESRIRSSVYSTPH 165
                                       G P +             PE  + S  YST  
Sbjct: 121 HRDLKPQNILINRDGVLKLADFGLARAFGIPLRTYTHEVVTLWYRAPEILLGSKHYSTAV 180

Query: 166 DVWAVGCIFAEMVSGKPLFPC-GKKDHLSLIVRYF 199
           D+W+VGCIFAEM++GKPLFP   + D L  I +  
Sbjct: 181 DIWSVGCIFAEMITGKPLFPGDSEIDQLFKIFQIL 215


Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the early G1 phase by CDK4 or CDK6, the G1/S phase transition by CDK2, or the entry of mitosis by CDK1. They also exhibit overlapping cyclin specificity and functions in certain conditions. Knockout mice with a single CDK deleted remain viable with specific phenotypes, showing that some CDKs can compensate for each other. For example, CDK4 can compensate for the loss of CDK6, however, double knockout mice with both CDK4 and CDK6 deleted die in utero. CDK8 and CDK9 are mainly involved in transcription while CDK5 is implicated in neuronal function. CDK7 plays essential roles in both the cell cycle as a CDK-Activating Kinase (CAK) and in transcription as a component of the general transcription factor TFIIH. Length = 282

>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 218
KOG0595 429 consensus Serine/threonine-protein kinase involved 100.0
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 99.97
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 99.97
KOG0575 592 consensus Polo-like serine/threonine protein kinas 99.97
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.97
KOG0598357 consensus Ribosomal protein S6 kinase and related 99.97
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 99.96
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 99.96
KOG0605 550 consensus NDR and related serine/threonine kinases 99.96
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 99.96
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.96
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.96
KOG0581364 consensus Mitogen-activated protein kinase kinase 99.96
KOG0616355 consensus cAMP-dependent protein kinase catalytic 99.95
KOG0694694 consensus Serine/threonine protein kinase [Signal 99.95
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.95
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 99.95
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 99.95
KOG0661 538 consensus MAPK related serine/threonine protein ki 99.95
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 99.95
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.94
KOG0583 370 consensus Serine/threonine protein kinase [Signal 99.94
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.94
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.94
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.94
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.94
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.94
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 99.94
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.94
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.94
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.94
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.94
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.94
KOG0192362 consensus Tyrosine kinase specific for activated ( 99.94
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.93
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.93
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.93
KOG0660359 consensus Mitogen-activated protein kinase [Signal 99.93
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.93
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 99.93
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.93
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.93
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.93
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.93
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.93
KOG0582 516 consensus Ste20-like serine/threonine protein kina 99.93
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.93
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.93
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.93
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.93
KOG0610 459 consensus Putative serine/threonine protein kinase 99.93
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.92
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.92
KOG0201 467 consensus Serine/threonine protein kinase [Signal 99.92
KOG0589 426 consensus Serine/threonine protein kinase [General 99.92
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.92
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.92
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.92
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.92
PTZ00036 440 glycogen synthase kinase; Provisional 99.92
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.92
KOG0690 516 consensus Serine/threonine protein kinase [Signal 99.92
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.92
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.92
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.92
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.92
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.92
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.92
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.92
KOG0578550 consensus p21-activated serine/threonine protein k 99.92
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.92
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.92
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.92
KOG0586 596 consensus Serine/threonine protein kinase [General 99.92
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.91
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.91
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.91
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.91
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.91
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.91
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.91
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.91
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.91
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.91
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.91
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.91
PTZ00283 496 serine/threonine protein kinase; Provisional 99.91
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.91
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.91
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.91
PHA02988283 hypothetical protein; Provisional 99.91
KOG0198313 consensus MEKK and related serine/threonine protei 99.91
KOG0033 355 consensus Ca2+/calmodulin-dependent protein kinase 99.91
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.91
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.91
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.91
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.91
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.91
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.91
PHA03212391 serine/threonine kinase US3; Provisional 99.91
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.91
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.91
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.91
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.91
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.91
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.91
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.91
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.91
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.91
PTZ00267 478 NIMA-related protein kinase; Provisional 99.91
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.91
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.91
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 99.9
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.9
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.9
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.9
PLN00009294 cyclin-dependent kinase A; Provisional 99.9
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.9
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.9
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.9
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.9
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.9
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.9
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.9
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.9
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.9
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.9
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.9
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.9
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.9
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.9
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.9
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.9
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.9
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.9
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.9
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.9
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.9
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.9
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.9
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.9
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.9
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.9
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.9
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.9
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.9
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.9
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.9
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.9
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.9
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.9
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.9
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.9
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.9
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.9
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.9
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.9
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.9
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.9
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.89
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.89
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.89
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.89
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.89
KOG0695 593 consensus Serine/threonine protein kinase [Signal 99.89
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.89
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.89
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.89
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.89
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.89
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.89
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.89
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.89
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.89
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.89
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.89
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.89
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.89
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.89
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.89
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.89
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.89
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.89
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.89
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.89
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.89
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.89
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.89
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.89
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.89
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.89
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.89
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.89
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.89
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.89
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.89
PTZ00284467 protein kinase; Provisional 99.89
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 99.89
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.89
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.89
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.89
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.89
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.89
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.89
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.89
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.89
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 99.89
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.89
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.89
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.89
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.89
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.88
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.88
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.88
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.88
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.88
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.88
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.88
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.88
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.88
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.88
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.88
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.88
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.88
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.88
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.88
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.88
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.88
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.88
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.88
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.88
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.88
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.88
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.88
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.88
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.88
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.88
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.88
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.88
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.88
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.88
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.88
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.88
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.88
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.88
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.88
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.88
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.88
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.88
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.88
PHA03207392 serine/threonine kinase US3; Provisional 99.87
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.87
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.87
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.87
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.87
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.87
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.87
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.87
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.87
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.87
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.87
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.87
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.87
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.87
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.87
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.87
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.87
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.87
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.87
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.87
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.87
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.87
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.87
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.87
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.87
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.87
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.87
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.87
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.87
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.87
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.87
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.87
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.87
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.87
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.87
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.87
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.87
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.87
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.87
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.87
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.86
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.86
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.86
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.86
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.86
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.86
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.86
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.86
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.86
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.86
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.86
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.86
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.86
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.86
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.86
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.86
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.86
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.86
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.86
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.86
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.86
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.86
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.86
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.86
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.86
KOG0607 463 consensus MAP kinase-interacting kinase and relate 99.86
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.86
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.86
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.86
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.86
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.86
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.86
PHA03209357 serine/threonine kinase US3; Provisional 99.86
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.86
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.85
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.85
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.85
KOG0596677 consensus Dual specificity; serine/threonine and t 99.85
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.85
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.85
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.85
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.85
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.85
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.85
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.85
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.85
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.85
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.85
PHA03211461 serine/threonine kinase US3; Provisional 99.85
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.85
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.85
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.85
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.85
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.85
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.84
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.84
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.84
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.84
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.84
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.84
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.84
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.84
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.84
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.84
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.84
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.84
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.84
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.84
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.84
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.83
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.83
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.83
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.83
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.83
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.83
PHA03210501 serine/threonine kinase US3; Provisional 99.82
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.82
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.82
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.82
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.82
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.81
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.81
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.81
KOG0608 1034 consensus Warts/lats-like serine threonine kinases 99.81
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.81
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.81
KOG0584 632 consensus Serine/threonine protein kinase [General 99.8
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.8
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.8
PHA02882294 putative serine/threonine kinase; Provisional 99.79
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 99.79
KOG0669 376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.78
KOG1152772 consensus Signal transduction serine/threonine kin 99.78
KOG3653534 consensus Transforming growth factor beta/activin 99.77
KOG0604 400 consensus MAP kinase-activated protein kinase 2 [S 99.77
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.77
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.76
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 99.75
KOG2052 513 consensus Activin A type IB receptor, serine/threo 99.74
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.74
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.72
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.71
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 99.69
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.68
KOG1345 378 consensus Serine/threonine kinase [Signal transduc 99.67
KOG0665 369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.64
KOG1027 903 consensus Serine/threonine protein kinase and endo 99.62
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.6
KOG1167 418 consensus Serine/threonine protein kinase of the C 99.59
PLN03224 507 probable serine/threonine protein kinase; Provisio 99.58
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 99.54
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.52
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.5
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.43
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 99.41
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.36
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.28
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.17
COG0515 384 SPS1 Serine/threonine protein kinase [General func 99.16
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.1
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.06
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.05
PRK09188 365 serine/threonine protein kinase; Provisional 99.05
PLN00181 793 protein SPA1-RELATED; Provisional 98.96
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 98.96
KOG0590601 consensus Checkpoint kinase and related serine/thr 98.9
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 98.86
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 98.79
PRK10345210 hypothetical protein; Provisional 98.74
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 98.68
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 98.64
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 98.6
PRK14879211 serine/threonine protein kinase; Provisional 98.49
PRK12274218 serine/threonine protein kinase; Provisional 98.42
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 98.4
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 98.37
smart00090237 RIO RIO-like kinase. 98.3
PRK09605535 bifunctional UGMP family protein/serine/threonine 98.17
KOG0590 601 consensus Checkpoint kinase and related serine/thr 98.17
KOG4158 598 consensus BRPK/PTEN-induced protein kinase [Signal 98.1
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 98.07
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 97.99
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 97.99
KOG1243 690 consensus Protein kinase [General function predict 97.97
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 97.93
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 97.76
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 97.65
KOG0606 1205 consensus Microtubule-associated serine/threonine 97.49
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 97.08
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 97.04
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 96.93
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 96.92
KOG1093 725 consensus Predicted protein kinase (contains TBC a 96.59
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 96.49
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 96.03
KOG1266 458 consensus Protein kinase [Signal transduction mech 94.98
KOG3087229 consensus Serine/threonine protein kinase [General 94.72
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 94.66
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 94.41
PLN02876 822 acyl-CoA dehydrogenase 94.41
KOG3741 655 consensus Poly(A) ribonuclease subunit [RNA proces 94.23
PRK09550 401 mtnK methylthioribose kinase; Reviewed 94.16
KOG0576 829 consensus Mitogen-activated protein kinase kinase 93.87
PRK10593 297 hypothetical protein; Provisional 93.79
PF01636239 APH: Phosphotransferase enzyme family This family 93.44
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 93.41
KOG1033 516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 92.56
COG0478304 RIO-like serine/threonine protein kinase fused to 92.49
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 92.26
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 90.2
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 89.97
PLN02756 418 S-methyl-5-thioribose kinase 89.86
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 89.8
COG4248 637 Uncharacterized protein with protein kinase and he 85.44
KOG1235 538 consensus Predicted unusual protein kinase [Genera 85.41
PF03881288 Fructosamin_kin: Fructosamine kinase; InterPro: IP 85.29
KOG2270 520 consensus Serine/threonine protein kinase involved 85.07
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 83.97
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 82.69
KOG2137 700 consensus Protein kinase [Signal transduction mech 80.05
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=3.9e-34  Score=230.29  Aligned_cols=159  Identities=35%  Similarity=0.629  Sum_probs=136.9

Q ss_pred             ccceeEEEEeeecCceEEEEEEEccCCcEEEEEEeecCCCCCCchHHHHHHHHHHhhCCCCCeeeeeeeEEeCCEEEEEE
Q 041487           40 DWNYKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKELEHDNIVRLLDVLTTGRYVYLVF  119 (218)
Q Consensus        40 ~~~~~~~~~ig~G~~g~v~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~e~~~l~~l~h~~iv~~~~~~~~~~~~~lv~  119 (218)
                      .++|.+.+.||+|+||+||+|+++.++..||||.+.+........+.+..|+.+|+.++|||||++++++..++.+|+||
T Consensus         9 ~~~y~~~~~iG~GsfavVykg~h~~~~~~VAIK~i~~~~l~~k~~e~L~~Ei~iLkel~H~nIV~l~d~~~~~~~i~lVM   88 (429)
T KOG0595|consen    9 VGDYELSREIGSGSFAVVYKGRHKKSGTEVAIKCIAKKKLNKKLVELLLSEIKILKELKHPNIVRLLDCIEDDDFIYLVM   88 (429)
T ss_pred             cccceehhhccCcceEEEEEeEeccCCceEEeeeehhhccCHHHHHHHHHHHHHHHhcCCcceeeEEEEEecCCeEEEEE
Confidence            57899999999999999999999999999999999877666677888999999999999999999999999999999999


Q ss_pred             ecCCC-ChHHHhhhcccC---------------------------Cccc-----------------cccccCCc------
Q 041487          120 EYLDL-DLGSFIRKHTIT---------------------------SIRP-----------------HIKEVGSP------  148 (218)
Q Consensus       120 E~~~~-~L~~~~~~~~~~---------------------------~~~~-----------------~~~~~g~~------  148 (218)
                      |||++ +|.+|+..++..                           |.+|                 ++++||.+      
T Consensus        89 EyC~gGDLs~yi~~~~~l~e~t~r~Fm~QLA~alq~L~~~~IiHRDLKPQNiLLs~~~~~~~~~~LKIADFGfAR~L~~~  168 (429)
T KOG0595|consen   89 EYCNGGDLSDYIRRRGRLPEATARHFMQQLASALQFLHENNIIHRDLKPQNILLSTTARNDTSPVLKIADFGFARFLQPG  168 (429)
T ss_pred             EeCCCCCHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHCCeeeccCCcceEEeccCCCCCCCceEEecccchhhhCCch
Confidence            99996 999999987543                           3333                 34455443      


Q ss_pred             -----------ccCcccccCCCCCCCcchHHHHHHHHHHHHhCCCCCCCCCcchHHHHHHHh
Q 041487          149 -----------YKAPESRIRSSVYSTPHDVWAVGCIFAEMVSGKPLFPCGKKDHLSLIVRYF  199 (218)
Q Consensus       149 -----------y~aPE~~~~~~~~~~~~DiwSlG~~l~~l~tg~~Pf~~~~~~~~~~~~~~~  199 (218)
                                 |||||+ .....|+.++|+||+|+++|++++|+.||+..+...+...++..
T Consensus       169 ~~a~tlcGSplYMAPEV-~~~~~YdAKADLWSiG~Ilyq~l~g~~Pf~a~t~~eL~~~~~k~  229 (429)
T KOG0595|consen  169 SMAETLCGSPLYMAPEV-IMSQQYDAKADLWSIGTILYQCLTGKPPFDAETPKELLLYIKKG  229 (429)
T ss_pred             hHHHHhhCCccccCHHH-HHhccccchhhHHHHHHHHHHHHhCCCCccccCHHHHHHHHhcc
Confidence                       999995 44556999999999999999999999999987777777766654



>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>PLN02756 S-methyl-5-thioribose kinase Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein [] Back     alignment and domain information
>KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 2e-25
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 1e-23
4eok_A 300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 1e-21
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 2e-06
4eoj_A 302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 1e-21
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 2e-06
4eom_A 301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 2e-21
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 2e-06
4eon_A 300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 2e-21
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 2e-06
2iw8_A 302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 3e-21
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 2e-06
2iw6_A 302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 4e-21
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 4e-21
4eos_A 300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 5e-21
1gz8_A 299 Human Cyclin Dependent Kinase 2 Complexed With The 5e-21
1e9h_A 297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 5e-21
3ezr_A 300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 5e-21
4eoq_A 301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 5e-21
4eop_A 300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 5e-21
4bcq_A 301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 5e-21
1vyw_A 309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 5e-21
4eoo_A 299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 5e-21
1w98_A 298 The Structural Basis Of Cdk2 Activation By Cyclin E 5e-21
4erw_A 306 Cdk2 In Complex With Staurosporine Length = 306 5e-21
4eoi_A 299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 6e-21
1jst_A 298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 6e-21
2w17_A 299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 6e-21
1fin_A 298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 6e-21
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 6e-21
3pj8_A 299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 6e-21
1pf8_A 298 Crystal Structure Of Human Cyclin-dependent Kinase 6e-21
1qmz_A 299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 6e-21
3qhr_A 298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 6e-21
3bht_A 300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 6e-21
4i3z_A 296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 6e-21
1h1p_A 303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 6e-21
3pxf_A 306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 6e-21
1ogu_A 302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 6e-21
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 6e-21
1gii_A 298 Human Cyclin Dependent Kinase 2 Complexed With The 1e-20
1oir_A 299 Imidazopyridines: A Potent And Selective Class Of C 3e-20
1h01_A 298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 3e-20
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 3e-20
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 4e-20
3mtl_A324 Crystal Structure Of The Pctaire1 Kinase In Complex 3e-19
1ung_A292 Structural Mechanism For The Inhibition Of Cdk5-P25 3e-19
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 1e-18
3gbz_A 329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 1e-17
3gbz_A329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 6e-05
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 3e-17
2pk9_A 317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 7e-17
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 3e-08
4aaa_A331 Crystal Structure Of The Human Cdkl2 Kinase Domain 1e-14
1ua2_A 346 Crystal Structure Of Human Cdk7 Length = 346 2e-13
1bi8_A 326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 2e-13
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 3e-07
1jow_B 308 Crystal Structure Of A Complex Of Human Cdk6 And A 3e-13
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 3e-07
4ec8_A 373 Structure Of Full Length Cdk9 In Complex With Cycli 3e-13
3nup_A 307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 3e-13
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 3e-07
3mi9_A 351 Crystal Structure Of Hiv-1 Tat Complexed With Human 3e-13
4bcf_A 331 Structure Of Cdk9 In Complex With Cyclin T And A 2- 4e-13
3blh_A 331 Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 4e-13
2w99_B 306 Crystal Structure Of Cdk4 In Complex With A D-Type 4e-13
2w99_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 3e-07
2w96_B 306 Crystal Structure Of Cdk4 In Complex With A D-Type 4e-13
2w96_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 3e-07
2w9f_B 306 Crystal Structure Of Cdk4 In Complex With A D-Type 4e-13
2w9f_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 3e-07
4e5a_X 360 The W197a Mutant Of P38a Map Kinase Length = 360 6e-11
3gcp_A 360 Human P38 Map Kinase In Complex With Sb203580 Lengt 8e-11
3d83_A 360 Crystal Structure Of P38 Kinase In Complex With A B 9e-11
3d7z_A 360 Crystal Structure Of P38 Kinase In Complex With A B 1e-10
2gtm_A348 Mutated Mouse P38 Map Kinase Domain In Complex With 1e-10
3tg1_A 380 Crystal Structure Of P38alpha In Complex With A Map 1e-10
1lew_A 360 Crystal Structure Of Map Kinase P38 Complexed To Th 1e-10
3gi3_A 360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 1e-10
2oza_B 366 Structure Of P38alpha Complex Length = 366 1e-10
3p4k_A 370 The Third Conformation Of P38a Map Kinase Observed 1e-10
2baq_A 365 P38alpha Bound To Ro3201195 Length = 365 1e-10
1bmk_A 379 The Complex Structure Of The Map Kinase P38SB218655 1e-10
2lgc_A359 Joint Nmr And X-Ray Refinement Reveals The Structur 2e-10
3od6_X 360 Crystal Structure Of P38alpha Y323t Active Mutant L 2e-10
3mh0_A 360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 2e-10
2fst_X 367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 2e-10
3hec_A348 P38 In Complex With Imatinib Length = 348 2e-10
1m7q_A 366 Crystal Structure Of P38 Map Kinase In Complex With 2e-10
3odz_X 360 Crystal Structure Of P38alpha Y323r Active Mutant L 2e-10
2npq_A 367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 2e-10
3o8p_A 360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 2e-10
3oef_X 360 Crystal Structure Of Y323f Inactive Mutant Of P38al 2e-10
2fso_X 367 Mitogen Activated Protein Kinase P38alpha (D176a) A 2e-10
3ody_X 360 Crystal Structure Of P38alpha Y323q Active Mutant L 2e-10
1oz1_A 372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 2e-10
3nnu_A354 Crystal Structure Of P38 Alpha In Complex With Dp13 2e-10
3fi4_A 372 P38 Kinase Crystal Structure In Complex With Ro4499 2e-10
2gfs_A 372 P38 Kinase Crystal Structure In Complex With Ro3201 2e-10
1ove_A 366 The Structure Of P38 Alpha In Complex With A Dihydr 2e-10
3s3i_A349 P38 Kinase Crystal Structure In Complex With Small 2e-10
2y8o_A 362 Crystal Structure Of Human P38alpha Complexed With 2e-10
3k3i_A350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 2e-10
3dt1_A 383 P38 Complexed With A Quinazoline Inhibitor Length = 2e-10
3k3j_A 362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 2e-10
3mh3_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 2e-10
3kq7_A 380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 2e-10
3mh1_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 2e-10
1di9_A 360 The Structure Of P38 Mitogen-Activated Protein Kina 2e-10
2baj_A 365 P38alpha Bound To Pyrazolourea Length = 365 2e-10
3hrb_A 359 P38 Kinase Crystal Structure In Complex With Small 2e-10
3gcu_A 360 Human P38 Map Kinase In Complex With Rl48 Length = 2e-10
3e92_A 371 Crystal Structure Of P38 Kinase In Complex With A B 2e-10
3mh2_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 2e-10
1zzl_A351 Crystal Structure Of P38 With Triazolopyridine Leng 2e-10
2puu_A348 Crystal Structure Of P38 Complex With 1-(5-Tert-But 2e-10
2bal_A 365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 2e-10
1ian_A 366 Human P38 Map Kinase Inhibitor Complex Length = 366 2e-10
3mpt_A 371 Crystal Structure Of P38 Kinase In Complex With A P 2e-10
2fsl_X 367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 2e-10
3zsg_A 362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 2e-10
3hvc_A 362 Crystal Structure Of Human P38alpha Map Kinase Leng 2e-10
1bl6_A 379 The Complex Structure Of The Map Kinase P38SB216995 2e-10
3oz6_A 388 Crystal Structure Of Mapk From Cryptosporidium Parv 3e-10
3oz6_A 388 Crystal Structure Of Mapk From Cryptosporidium Parv 2e-05
3g33_A 308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 5e-10
3g33_A308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 3e-07
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 8e-10
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 1e-09
4ewq_A 383 Human P38 Alpha Mapk In Complex With A Pyridazine B 1e-09
1yhv_A 297 Crystal Structure Of Pak1 Kinase Domain With Two Po 2e-09
3q52_A 306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 2e-09
3fxz_A 297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 2e-09
3coi_A353 Crystal Structure Of P38delta Kinase Length = 353 5e-09
4exu_A371 Mapk13, Inactive Form Length = 371 6e-09
3mfr_A 351 Cask-4m Cam Kinase Domain, Native Length = 351 2e-08
3oht_A 389 Crystal Structure Of Salmo Salar P38alpha Length = 2e-08
3iec_A 319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 3e-08
2r0i_A 327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 3e-08
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 3e-08
1zmu_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-08
1zmw_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-08
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 3e-08
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 3e-08
3c0g_A 351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 4e-08
3tac_A 361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 4e-08
1zmv_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 5e-08
2wzj_A 327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 5e-08
2qnj_A 328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 8e-08
3fe3_A 328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 8e-08
1y8g_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-07
4azf_A417 Human Dyrk2 In Complex With Leucettine L41 Length = 1e-07
3k2l_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 1e-07
3kvw_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 1e-07
3kk8_A 284 Camkii Substrate Complex A Length = 284 2e-07
3kk9_A282 Camkii Substrate Complex B Length = 282 2e-07
2bdw_A 362 Crystal Structure Of The Auto-Inhibited Kinase Doma 2e-07
2hak_A 328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 2e-07
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 2e-07
2wel_A 327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 3e-07
2vn9_A 301 Crystal Structure Of Human Calcium Calmodulin Depen 3e-07
1cm8_A 367 Phosphorylated Map Kinase P38-Gamma Length = 367 4e-07
1cm8_A 367 Phosphorylated Map Kinase P38-Gamma Length = 367 3e-05
3bhh_A 295 Crystal Structure Of Human Calcium/calmodulin-depen 5e-07
1luf_A 343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 7e-07
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 8e-07
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 8e-07
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 8e-07
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 8e-07
3lij_A 494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 8e-07
2jfm_A 325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 8e-07
2j51_A 325 Crystal Structure Of Human Ste20-Like Kinase Bound 8e-07
3sa0_A360 Complex Of Erk2 With Norathyriol Length = 360 9e-07
4gsb_A364 Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 9e-07
4fv7_A360 Crystal Structure Of The Erk2 Complexed With E94 Le 9e-07
4fux_A360 Crystal Structure Of The Erk2 Complexed With E75 Le 9e-07
2jfl_A 325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 9e-07
1wzy_A368 Crystal Structure Of Human Erk2 Complexed With A Py 9e-07
1tvo_A 368 The Structure Of Erk2 In Complex With A Small Molec 9e-07
3qyw_A364 Crystal Structure Of Erk2 In Complex With An Inhibi 9e-07
3r63_A358 Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 9e-07
4fv6_A360 Crystal Structure Of The Erk2 Complexed With E57 Le 9e-07
3o71_A358 Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length 9e-07
4h3q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 9e-07
1gol_A364 Coordinates Of Rat Map Kinase Erk2 With An Arginine 9e-07
3zuv_A364 Crystal Structure Of A Designed Selected Ankyrin Re 9e-07
3zu7_A365 Crystal Structure Of A Designed Selected Ankyrin Re 9e-07
2z7l_A366 Unphosphorylated Mitogen Activated Protein Kinase E 9e-07
3c9w_A357 Crystal Structure Of Erk-2 With Hypothemycin Covale 9e-07
2fys_B364 Crystal Structure Of Erk2 Complex With Kim Peptide 9e-07
2erk_A365 Phosphorylated Map Kinase Erk2 Length = 365 9e-07
3tei_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 1e-06
2y9q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 1e-06
1pme_A380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 1e-06
2ojg_A380 Crystal Structure Of Erk2 In Complex With N,n-dimet 1e-06
2gph_A364 Docking Motif Interactions In The Map Kinase Erk2 L 1e-06
2zoq_A382 Structural Dissection Of Human Mitogen-Activated Ki 1e-06
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 2e-06
3hzt_A 467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 2e-06
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 2e-06
3rgf_A 405 Crystal Structure Of Human Cdk8CYCC Length = 405 2e-06
2x4f_A 373 The Crystal Structure Of The Human Myosin Light Cha 2e-06
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 2e-06
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 2e-06
3gc9_A 370 The Structure Of P38beta C119s, C162s In Complex Wi 2e-06
3hmn_A 342 Crystal Structure Of Human Mps1 Catalytic Domain In 3e-06
3cek_A 313 Crystal Structure Of Human Dual Specificity Protein 3e-06
3dbq_A 343 Crystal Structure Of Ttk Kinase Domain Length = 343 3e-06
2zmd_A 390 Crystal Structure Of Human Mps1 Catalytic Domain T6 3e-06
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 3e-06
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 3e-06
2zmc_A 390 Crystal Structure Of Human Mitotic Checkpoint Kinas 3e-06
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 3e-06
3h9f_A 313 Crystal Structure Of Human Dual Specificity Protein 3e-06
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 3e-06
2x9e_A 317 Human Mps1 In Complex With Nms-P715 Length = 317 3e-06
3vqu_A 320 Crystal Structure Of Human Mps1 Catalytic Domain In 4e-06
4gt5_A 306 Crystal Structure Of The Inactive Trka Kinase Domai 4e-06
4f0i_A 300 Crystal Structure Of Apo Trka Length = 300 4e-06
4aoj_A 329 Human Trka In Complex With The Inhibitor Az-23 Leng 4e-06
3i7c_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 4e-06
3gp0_A348 Crystal Structure Of Human Mitogen Activated Protei 5e-06
3e3p_A360 Glycogen Synthase Kinase From Leishmania Major Leng 5e-06
3nnx_A354 Crystal Structure Of Phosphorylated P38 Alpha In Co 5e-06
1ywr_A 360 Crystal Structure Analysis Of Inactive P38 Kinase D 5e-06
1yw2_A 360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 5e-06
2ghl_A 348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 5e-06
2ghl_A348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 6e-06
3gc8_A 370 The Structure Of P38beta C162s In Complex With A Di 6e-06
3py3_A 380 Crystal Structure Of Phosphorylated P38alpha Map Ki 6e-06
3py3_A 380 Crystal Structure Of Phosphorylated P38alpha Map Ki 6e-06
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 6e-06
2vz6_A 313 Structure Of Human Calcium Calmodulin Dependent Pro 8e-06
4e7w_A 394 Structure Of Gsk3 From Ustilago Maydis Length = 394 9e-06
2b9h_A353 Crystal Structure Of Fus3 With A Docking Motif From 1e-05
2b9f_A353 Crystal Structure Of Non-Phosphorylated Fus3 Length 1e-05
2f9g_A353 Crystal Structure Of Fus3 Phosphorylated On Tyr182 1e-05
3q5i_A 504 Crystal Structure Of Pbanka_031420 Length = 504 1e-05
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 1e-05
3jy9_A 311 Janus Kinase 2 Inhibitors Length = 311 1e-05
3io7_A 313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 1e-05
1z57_A 339 Crystal Structure Of Human Clk1 In Complex With 10z 2e-05
1z57_A339 Crystal Structure Of Human Clk1 In Complex With 10z 2e-04
2r0u_A 323 Crystal Structure Of Chek1 In Complex With Inhibito 2e-05
2vag_A 339 Crystal Structure Of Di-Phosphorylated Human Clk1 I 2e-05
2vag_A339 Crystal Structure Of Di-Phosphorylated Human Clk1 I 2e-04
2hog_A 322 Crystal Structure Of Chek1 In Complex With Inhibito 2e-05
3eb0_A 383 Crystal Structure Of Cgd4_240 From Cryptosporidium 2e-05
3fv8_A355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 2e-05
3com_A 314 Crystal Structure Of Mst1 Kinase Length = 314 2e-05
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 2e-05
2br1_A 297 Structure-Based Design Of Novel Chk1 Inhibitors: In 2e-05
1ia8_A 289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 2e-05
1zlt_A 295 Crystal Structure Of Chk1 Complexed With A Hymenald 2e-05
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 2e-05
3fi2_A353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 2e-05
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 2e-05
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 2e-05
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 2e-05
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 2e-05
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 2e-05
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 2e-05
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 2e-05
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 3e-05
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 3e-05
4ic7_A 442 Crystal Structure Of The Erk5 Kinase Domain In Comp 3e-05
4ic7_A 442 Crystal Structure Of The Erk5 Kinase Domain In Comp 4e-04
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 3e-05
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 3e-05
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 3e-05
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 3e-05
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 3e-05
4fst_A269 Crystal Structure Of The Chk1 Length = 269 3e-05
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 3e-05
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 3e-05
2v7o_A 336 Crystal Structure Of Human Calcium-Calmodulin-Depen 3e-05
4b99_A 398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 3e-05
4b99_A 398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 2e-04
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 3e-05
4asz_A 299 Crystal Structure Of Apo Trkb Kinase Domain Length 3e-05
3fi3_A 364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 3e-05
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 3e-05
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 3e-05
3h4j_B 336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 3e-05
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 3e-05
3soa_A 444 Full-Length Human Camkii Length = 444 3e-05
4bc6_A 293 Crystal Structure Of Human Serine Threonine Kinase- 3e-05
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 3e-05
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 4e-05
2i6l_A320 Crystal Structure Of Human Mitogen Activated Protei 4e-05
1kob_A 387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 4e-05
2j7t_A 302 Crystal Structure Of Human Serine Threonine Kinase- 4e-05
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 4e-05
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 4e-05
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 4e-05
2qoo_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-05
2qoi_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-05
3dzq_A 361 Human Epha3 Kinase Domain In Complex With Inhibitor 4e-05
2qok_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-05
2qoc_A 344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 4e-05
2qol_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 4e-05
2qof_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 4e-05
2qod_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 4e-05
2gsf_A 373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 5e-05
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 5e-05
3fxx_A 371 Human Epha3 Kinase And Juxtamembrane Region Bound T 5e-05
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 5e-05
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 5e-05
2pl0_A289 Lck Bound To Imatinib Length = 289 5e-05
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 5e-05
3zgw_A 347 Crystal Structure Of Maternal Embryonic Leucine Zip 5e-05
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 5e-05
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 5e-05
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 5e-05
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 5e-05
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 5e-05
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 5e-05
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 5e-05
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 5e-05
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 5e-05
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 5e-05
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 5e-05
4eqm_A 294 Structural Analysis Of Staphylococcus Aureus Serine 5e-05
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 5e-05
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 5e-05
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 5e-05
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 5e-05
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 6e-05
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 6e-05
3zdi_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 6e-05
3f7z_A350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 6e-05
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 6e-05
3gb2_A353 Gsk3beta Inhibitor Complex Length = 353 6e-05
3f88_A349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 6e-05
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 6e-05
2uv2_A 287 Crystal Structure Of Human Ste20-Like Kinase Bound 6e-05
2ow3_A352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 6e-05
1o9u_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 6e-05
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 6e-05
4dit_A 382 Crystal Structure Of Gsk3beta In Complex With A Imi 6e-05
1gng_A 378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 6e-05
2r9s_A 356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 6e-05
1pmn_A 364 Crystal Structure Of Jnk3 In Complex With An Imidaz 6e-05
4afj_A 367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 6e-05
3oxi_A 362 Design And Synthesis Of Disubstituted Thiophene And 6e-05
3kvx_A 364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 6e-05
3ttj_A 464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 6e-05
3zrk_A 371 Identification Of 2-(4-Pyridyl)thienopyridinones As 6e-05
2b1p_A 355 Inhibitor Complex Of Jnk3 Length = 355 6e-05
3sd0_A350 Identification Of A Glycogen Synthase Kinase-3b Inh 7e-05
4h36_A 356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 7e-05
1r0e_A 391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 7e-05
3ptg_A 363 Design And Synthesis Of A Novel, Orally Efficacious 7e-05
2o0u_A 364 Crystal Structure Of Human Jnk3 Complexed With N-{3 7e-05
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 7e-05
1uv5_A350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 7e-05
2o5k_A 372 Crystal Structure Of Gsk3beta In Complex With A Ben 7e-05
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 7e-05
2ok1_A 365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 7e-05
1h8f_A352 Glycogen Synthase Kinase 3 Beta. Length = 352 7e-05
2exc_X 356 Inhibitor Complex Of Jnk3 Length = 356 7e-05
3say_A 430 Crystal Structure Of Human Glycogen Synthase Kinase 7e-05
1q5k_A 414 Crystal Structure Of Glycogen Synthase Kinase 3 In 7e-05
1jnk_A 423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 8e-05
4acc_A 465 Gsk3b In Complex With Inhibitor Length = 465 8e-05
1i09_A 420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 8e-05
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 8e-05
3dls_A 335 Crystal Structure Of Human Pas Kinase Bound To Adp 8e-05
1pyx_A 422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 8e-05
1q3d_A 424 Gsk-3 Beta Complexed With Staurosporine Length = 42 8e-05
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 8e-05
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 1e-04
3gu4_A 295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 1e-04
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 1e-04
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 1e-04
4bbe_A 298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 1e-04
3vui_A 370 Crystal Structure Of A Cysteine-deficient Mutant M2 1e-04
3rny_A 346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 1e-04
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 1e-04
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 1e-04
2wnt_A 330 Crystal Structure Of The Human Ribosomal Protein S6 1e-04
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 1e-04
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 1e-04
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 1e-04
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 1e-04
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 1e-04
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 1e-04
2jam_A 304 Crystal Structure Of Human Calmodulin-Dependent Pro 1e-04
3a7f_A303 Human Mst3 Kinase Length = 303 1e-04
1a06_A 332 Calmodulin-Dependent Protein Kinase From Rat Length 2e-04
3v5q_A 297 Discovery Of A Selective Trk Inhibitor With Efficac 2e-04
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 2e-04
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 2e-04
3nie_A 429 Crystal Structure Of Pf11_0147 Length = 429 2e-04
4fg9_A 320 Crystal Structure Of Human Calcium/calmodulin-depen 2e-04
4fg8_A 315 Crystal Structure Of Human Calcium/calmodulin-depen 2e-04
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 2e-04
3n9x_A 432 Crystal Structure Of Map Kinase From Plasmodium Ber 2e-04
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 2e-04
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 2e-04
3bhy_A283 Crystal Structure Of Human Death Associated Protein 2e-04
3tjc_A 298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 3e-04
3a4o_X286 Lyn Kinase Domain Length = 286 3e-04
2qr7_A 342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 3e-04
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 3e-04
2qon_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 3e-04
3npc_A 364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 3e-04
2xuu_A 334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 3e-04
2qob_A 344 Human Epha3 Kinase Domain, Base Structure Length = 3e-04
2qr8_A 342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 3e-04
2x0g_A 334 X-ray Structure Of A Dap-kinase Calmodulin Complex 3e-04
2qo7_A 373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 4e-04
3e62_A 293 Fragment Based Discovery Of Jak-2 Inhibitors Length 4e-04
3e7o_A 360 Crystal Structure Of Jnk2 Length = 360 4e-04
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 4e-04
3q32_A 301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 4e-04
2b7a_A 293 The Structural Basis Of Janus Kinase 2 Inhibition B 4e-04
2jc6_A 334 Crystal Structure Of Human Calmodulin-Dependent Pro 4e-04
3ugc_A 295 Structural Basis Of Jak2 Inhibition By The Type Ii 4e-04
3rvg_A 303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 4e-04
2w1i_A 326 Structure Determination Of Aurora Kinase In Complex 4e-04
3lpb_A 295 Crystal Structure Of Jak2 Complexed With A Potent 2 4e-04
4hge_A 300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 4e-04
4aqc_A 301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 4e-04
4e4m_A 302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 4e-04
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 4e-04
1ig1_A 294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 4e-04
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 4e-04
2w4k_A 302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 4e-04
1p4f_A 293 Death Associated Protein Kinase Catalytic Domain Wi 5e-04
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 5e-04
3f5u_A 295 Crystal Structure Of The Death Associated Protein K 5e-04
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 5e-04
2xzs_A 312 Death Associated Protein Kinase 1 Residues 1-312 Le 5e-04
3dfc_B 295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 5e-04
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 5e-04
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 5e-04
2y0a_A 326 Structure Of Dapk1 Construct Residues 1-304 Length 5e-04
3i81_A 315 Crystal Structure Of Insulin-Like Growth Factor 1 R 5e-04
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 5e-04
1k3a_A 299 Structure Of The Insulin-Like Growth Factor 1 Recep 6e-04
2vwu_A 302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 6e-04
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 6e-04
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 6e-04
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 6e-04
2zm3_A 308 Complex Structure Of Insulin-Like Growth Factor Rec 6e-04
3o23_A 305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 6e-04
2oj9_A 307 Structure Of Igf-1r Kinase Domain Complexed With A 6e-04
1m7n_A 322 Crystal Structure Of Unactivated Apo Insulin-Like G 6e-04
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 6e-04
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 6e-04
3qqu_A 301 Cocrystal Structure Of Unphosphorylated Igf With Py 6e-04
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 6e-04
3lvp_A 336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 6e-04
3d94_A 301 Crystal Structure Of The Insulin-Like Growth Factor 6e-04
1jqh_A 308 Igf-1 Receptor Kinase Domain Length = 308 6e-04
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 6e-04
3lco_A 324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 6e-04
1na7_A329 Crystal Structure Of The Catalytic Subunit Of Human 7e-04
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 8e-04
3a60_A 327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 9e-04
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure

Iteration: 1

Score = 112 bits (280), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 78/215 (36%), Positives = 102/215 (47%), Gaps = 59/215 (27%) Query: 42 NYKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKELEHDN 101 N++ VEKIG+G +G VYK N TG+ VA+K I + E EGVPS I +SLLKEL H N Sbjct: 4 NFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPN 63 Query: 102 IVRLLDVLTTGRYVYLVFEYLDLDLG---------------------------SFIRKHT 134 IV+LLDV+ T +YLVFE+L DL SF H Sbjct: 64 IVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLSFCHSHR 123 Query: 135 I--TSIRPH-----------------IKEVGSP------------YKAPESRIRSSVYST 163 + ++P + G P Y+APE + YST Sbjct: 124 VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYST 183 Query: 164 PHDVWAVGCIFAEMVSGKPLFPCGKK-DHLSLIVR 197 D+W++GCIFAEMV+ + LFP + D L I R Sbjct: 184 AVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFR 218
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 Back     alignment and structure
>pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 Back     alignment and structure
>pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 Back     alignment and structure
>pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 Back     alignment and structure
>pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 Back     alignment and structure
>pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 Back     alignment and structure
>pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 Back     alignment and structure
>pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 Back     alignment and structure
>pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 Back     alignment and structure
>pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 Back     alignment and structure
>pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 Back     alignment and structure
>pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 Back     alignment and structure
>pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 Back     alignment and structure
>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 Back     alignment and structure
>pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 Back     alignment and structure
>pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 Back     alignment and structure
>pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 Back     alignment and structure
>pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|3RGF|A Chain A, Crystal Structure Of Human Cdk8CYCC Length = 405 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 Back     alignment and structure
>pdb|3CEK|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (ttk) Length = 313 Back     alignment and structure
>pdb|3DBQ|A Chain A, Crystal Structure Of Ttk Kinase Domain Length = 343 Back     alignment and structure
>pdb|2ZMD|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain T686a Mutant In Complex With Sp600125 Inhibitor Length = 390 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3H9F|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (Ttk) In Complex With A Pyrimido-Diazepin Ligand Length = 313 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|2X9E|A Chain A, Human Mps1 In Complex With Nms-P715 Length = 317 Back     alignment and structure
>pdb|3VQU|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With 4- [(4-Amino-5-Cyano-6-Ethoxypyridin-2- Yl)amino]benzamide Length = 320 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|3E3P|A Chain A, Glycogen Synthase Kinase From Leishmania Major Length = 360 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 Back     alignment and structure
>pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|1Z57|A Chain A, Crystal Structure Of Human Clk1 In Complex With 10z-Hymenialdisine Length = 339 Back     alignment and structure
>pdb|1Z57|A Chain A, Crystal Structure Of Human Clk1 In Complex With 10z-Hymenialdisine Length = 339 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|2VAG|A Chain A, Crystal Structure Of Di-Phosphorylated Human Clk1 In Complex With A Novel Substituted Indole Inhibitor Length = 339 Back     alignment and structure
>pdb|2VAG|A Chain A, Crystal Structure Of Di-Phosphorylated Human Clk1 In Complex With A Novel Substituted Indole Inhibitor Length = 339 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum In Complex With Indirubin E804 Length = 383 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|3NIE|A Chain A, Crystal Structure Of Pf11_0147 Length = 429 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|3N9X|A Chain A, Crystal Structure Of Map Kinase From Plasmodium Berghei, Pb000659.00.0 Length = 432 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|1NA7|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 Length = 329 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 1e-50
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 3e-48
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 9e-46
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 2e-45
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 1e-43
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 2e-43
3o0g_A292 Cell division protein kinase 5; kinase activator c 2e-43
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 7e-38
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 2e-37
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 3e-34
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 1e-12
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 1e-33
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 3e-13
3niz_A 311 Rhodanese family protein; structural genomics, str 2e-33
3niz_A311 Rhodanese family protein; structural genomics, str 9e-13
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 2e-31
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 1e-11
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 1e-29
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 5e-29
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 4e-28
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 8e-28
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 8e-26
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 4e-12
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 7e-23
3rp9_A 458 Mitogen-activated protein kinase; structural genom 2e-22
3rp9_A 458 Mitogen-activated protein kinase; structural genom 6e-10
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 1e-21
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 4e-14
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 2e-20
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 1e-05
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 3e-20
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 4e-14
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 1e-19
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 4e-19
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 3e-05
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 5e-19
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 8e-08
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 7e-19
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 1e-18
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 3e-18
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-05
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 4e-18
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 4e-18
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 5e-18
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 3e-13
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 7e-18
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 9e-13
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 8e-18
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 8e-18
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 1e-17
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 1e-17
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 6e-13
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 2e-17
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 2e-17
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 2e-17
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 3e-17
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 3e-17
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 3e-17
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 4e-17
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 4e-17
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 4e-17
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 2e-04
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 4e-17
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 5e-17
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 5e-17
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 2e-04
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 5e-17
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 5e-17
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 7e-17
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 7e-17
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 9e-17
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 1e-16
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 1e-16
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 2e-04
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 1e-16
3bhy_A283 Death-associated protein kinase 3; death associate 1e-16
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 1e-16
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 1e-16
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 7e-13
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 1e-16
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 4e-09
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 1e-16
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 2e-16
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 2e-16
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 2e-16
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 2e-16
2a19_B284 Interferon-induced, double-stranded RNA-activated 3e-16
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 3e-16
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 3e-16
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 1e-12
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 4e-16
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 4e-16
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 4e-16
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 4e-16
2eue_A275 Carbon catabolite derepressing protein kinase; kin 4e-16
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 5e-16
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 5e-16
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 5e-16
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 5e-16
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 3e-13
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 6e-16
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 6e-16
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 6e-16
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 7e-16
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 9e-16
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 9e-16
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 9e-16
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 1e-15
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 1e-15
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 1e-15
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 1e-15
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 2e-15
4aoj_A 329 High affinity nerve growth factor receptor; transf 2e-15
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 3e-15
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 3e-15
3v5q_A 297 NT-3 growth factor receptor; kinase domain, kinase 3e-15
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 3e-15
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 3e-15
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 4e-15
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 4e-15
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 5e-15
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 1e-12
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 5e-15
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 5e-15
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 2e-12
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 5e-15
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 5e-15
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 6e-15
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 6e-15
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 7e-15
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 1e-11
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 7e-15
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 8e-15
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 8e-15
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 5e-11
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 8e-15
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 1e-14
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 1e-12
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 1e-14
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 1e-14
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 1e-14
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 1e-14
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 1e-14
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 2e-14
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 6e-04
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 2e-14
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-14
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 2e-14
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 2e-14
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 2e-14
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 2e-14
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 3e-14
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 8e-04
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 3e-14
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 3e-14
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 4e-14
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 4e-14
3pls_A298 Macrophage-stimulating protein receptor; protein k 5e-14
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 5e-14
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 2e-12
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 6e-14
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 8e-14
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 8e-14
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 1e-13
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 1e-13
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 1e-13
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 2e-13
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 2e-13
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 2e-13
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 2e-13
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 5e-08
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 2e-13
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 2e-13
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 2e-08
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 3e-13
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 3e-13
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 4e-13
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 4e-13
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 5e-13
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 5e-13
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 6e-13
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 6e-13
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 8e-13
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 1e-12
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 2e-12
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 5e-08
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 2e-12
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-12
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 2e-12
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 3e-12
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 3e-12
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 5e-12
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 5e-12
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 5e-12
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 6e-12
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 6e-12
3aln_A 327 Dual specificity mitogen-activated protein kinase; 7e-12
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 1e-11
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 2e-08
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-11
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 1e-11
3uqc_A286 Probable conserved transmembrane protein; structur 1e-11
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 2e-11
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 2e-11
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 3e-11
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 3e-11
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 3e-11
3eqc_A360 Dual specificity mitogen-activated protein kinase; 2e-04
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 3e-11
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 3e-11
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 3e-11
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 3e-11
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 4e-11
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 5e-11
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 6e-11
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 9e-11
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 1e-10
2dyl_A 318 Dual specificity mitogen-activated protein kinase 1e-10
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 2e-10
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 2e-10
3fme_A 290 Dual specificity mitogen-activated protein kinase; 2e-10
3an0_A 340 Dual specificity mitogen-activated protein kinase; 4e-10
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 5e-10
3soc_A 322 Activin receptor type-2A; structural genomics cons 5e-10
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 5e-10
3q4u_A 301 Activin receptor type-1; structural genomics conso 5e-10
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 1e-09
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 2e-09
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-05
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 2e-09
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 2e-09
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 3e-09
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 6e-09
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 6e-09
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 9e-09
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 1e-08
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 1e-08
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 2e-08
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 3e-08
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 9e-08
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 2e-07
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 1e-06
3ork_A 311 Serine/threonine protein kinase; structural genomi 3e-07
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 4e-07
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 4e-07
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 1e-06
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 2e-06
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 6e-06
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 2e-05
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 2e-05
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 1e-04
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
 Score =  165 bits (421), Expect = 1e-50
 Identities = 59/215 (27%), Positives = 93/215 (43%), Gaps = 60/215 (27%)

Query: 42  NYKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKELEHDN 101
            Y+ + KIG+G +G V+KC N +TG+ VAIK      +   +    +  + +LK+L+H N
Sbjct: 4   KYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPN 63

Query: 102 IVRLLDVLTTGRYVYLVFEYLDLDLGSFIRKHTITSIRPHIK------------------ 143
           +V LL+V    R ++LVFEY D  +   + ++        +K                  
Sbjct: 64  LVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNC 123

Query: 144 ---------------------------EVGSP------------YKAPESRIRSSVYSTP 164
                                       +  P            Y++PE  +  + Y  P
Sbjct: 124 IHRDVKPENILITKHSVIKLCDFGFARLLTGPSDYYDDEVATRWYRSPELLVGDTQYGPP 183

Query: 165 HDVWAVGCIFAEMVSGKPLFPCGK--KDHLSLIVR 197
            DVWA+GC+FAE++SG PL+P GK   D L LI +
Sbjct: 184 VDVWAIGCVFAELLSGVPLWP-GKSDVDQLYLIRK 217


>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.98
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.97
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.97
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.97
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.97
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 99.97
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.96
3niz_A311 Rhodanese family protein; structural genomics, str 99.96
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.96
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.96
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.96
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.95
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.95
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.95
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.95
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.95
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.95
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.95
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.95
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.95
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.95
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.95
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.95
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.95
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.95
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.95
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.95
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.95
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.95
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.95
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.95
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.95
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.95
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.95
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.95
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.95
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.95
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.95
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.95
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.95
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.95
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.95
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.94
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.94
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.94
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.94
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.94
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.94
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.94
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.94
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.94
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.94
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.94
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.94
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.94
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.94
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.94
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.94
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.94
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 99.94
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.94
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.94
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.94
3ork_A311 Serine/threonine protein kinase; structural genomi 99.94
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.94
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.94
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.94
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.94
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.94
3bhy_A283 Death-associated protein kinase 3; death associate 99.94
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.94
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.94
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.94
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.94
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.94
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.94
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.94
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.94
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.94
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.94
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.94
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.94
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.94
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.94
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.93
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.93
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.93
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.93
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.93
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.93
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.93
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.93
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.93
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.93
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.93
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.93
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.93
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.93
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.93
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.93
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.93
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.93
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.93
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.93
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.93
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.93
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.93
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.93
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.93
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.93
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.93
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.93
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.93
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.93
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.93
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.93
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.93
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.93
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.93
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.93
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.93
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.93
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.93
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.93
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.93
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.93
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.93
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.93
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.93
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.93
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.93
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.93
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.93
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.93
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.93
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.93
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.93
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.93
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.93
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.93
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.93
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 99.93
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.93
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.93
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.93
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.92
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.92
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.92
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.92
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.92
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.92
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.92
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.92
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.92
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.92
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.92
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.92
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.92
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.92
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.92
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.92
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.92
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.92
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.92
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.92
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.92
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.92
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.92
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.92
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.92
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.92
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.92
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.92
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.92
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.92
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.92
3uqc_A286 Probable conserved transmembrane protein; structur 99.92
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.92
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.92
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.92
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.92
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.92
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.92
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.91
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.91
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.91
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.91
3soc_A322 Activin receptor type-2A; structural genomics cons 99.91
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.91
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.91
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.91
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.91
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.91
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.91
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.91
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.91
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.91
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.91
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.91
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.91
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.91
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.91
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.91
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.91
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.91
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.91
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.9
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.9
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.9
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.9
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.9
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.9
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.9
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.9
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.9
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.9
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.9
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.9
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.89
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.89
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.89
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.89
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.89
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.89
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.89
3q4u_A301 Activin receptor type-1; structural genomics conso 99.89
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.88
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.88
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.88
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.87
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.87
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.86
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.86
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.86
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.86
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.86
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.82
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.81
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.53
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.32
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 98.9
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 98.6
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 98.23
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 97.88
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 97.07
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 96.63
3dxp_A 359 Putative acyl-COA dehydrogenase; protein kinase-li 95.87
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 95.65
3jr1_A 312 Putative fructosamine-3-kinase; YP_719053.1, struc 95.58
2olc_A 397 MTR kinase, methylthioribose kinase; kinase ADP-2H 95.09
3f7w_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 94.52
3ovc_A 362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 93.65
3r70_A 320 Aminoglycoside phosphotransferase; structural geno 93.37
3tdw_A 306 Gentamicin resistance protein; kinase, phosphoryl 92.52
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 91.18
3ats_A 357 Putative uncharacterized protein; hypothetical pro 87.84
2q83_A 346 YTAA protein; 2635576, structural genomics, joint 85.54
3sg8_A 304 APH(2'')-ID; antibiotic resistance enzyme, transfe 85.52
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
Probab=100.00  E-value=1.9e-36  Score=248.55  Aligned_cols=177  Identities=26%  Similarity=0.403  Sum_probs=134.1

Q ss_pred             hccceeEEEEeeecCceEEEEEEEccCCcEEEEEEeecCCCCCCchHHHHHHHHHHhhCCCCCeeeeeeeEEeCCEEEEE
Q 041487           39 KDWNYKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKELEHDNIVRLLDVLTTGRYVYLV  118 (218)
Q Consensus        39 ~~~~~~~~~~ig~G~~g~v~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~e~~~l~~l~h~~iv~~~~~~~~~~~~~lv  118 (218)
                      ..++|++++.||+|+||.||+|+++.+++.||||++.+........+.+.+|+.++++++|||||++++++.+.+.+|+|
T Consensus        22 sme~Y~~~~~lG~G~fg~V~~a~~~~~~~~vAiK~i~~~~~~~~~~~~~~~E~~il~~l~HpnIV~~~~~~~~~~~~yiV  101 (350)
T 4b9d_A           22 SMEKYVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEENGSLYIV  101 (350)
T ss_dssp             CCCCEEEEEEC------CEEEEEETTTCCEEEEEEEECTTSCHHHHHHHHHHHHHHHHCCCTTBCCEEEEEEETTEEEEE
T ss_pred             cccceEEeEEEecCCCeEEEEEEECCCCCEEEEEEEehHHCCHHHHHHHHHHHHHHHHCCCCCCCcEEEEEEECCEEEEE
Confidence            35789999999999999999999999999999999987665555678899999999999999999999999999999999


Q ss_pred             EecCCC-ChHHHhhhcccC-----------------------------Cccccc-----------ccc------------
Q 041487          119 FEYLDL-DLGSFIRKHTIT-----------------------------SIRPHI-----------KEV------------  145 (218)
Q Consensus       119 ~E~~~~-~L~~~~~~~~~~-----------------------------~~~~~~-----------~~~------------  145 (218)
                      ||||++ +|.+++......                             |++|.+           .+|            
T Consensus       102 mEy~~gg~L~~~i~~~~~~~~~e~~~~~~~~qi~~aL~ylH~~~IiHRDlKp~NILl~~~g~vKl~DFGla~~~~~~~~~  181 (350)
T 4b9d_A          102 MDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVEL  181 (350)
T ss_dssp             EECCTTCBHHHHHHHTTTCCCCHHHHHHHHHHHHHHHHHHHHTTCEETTCCGGGEEECTTCCEEECSTTEESCCCHHHHH
T ss_pred             EeCCCCCcHHHHHHHcCCCCCCHHHHHHHHHHHHHHHHHHHHCCeeeccCCHHHEEECCCCCEEEcccccceeecCCccc
Confidence            999987 999998654221                             444443           233            


Q ss_pred             -----CC-cccCcccccCCCCCCCcchHHHHHHHHHHHHhCCCCCCCCCcchHHHHHHHhcccCcccc----hhhhhhhc
Q 041487          146 -----GS-PYKAPESRIRSSVYSTPHDVWAVGCIFAEMVSGKPLFPCGKKDHLSLIVRYFTALTNYLV----LPCFLSIM  215 (218)
Q Consensus       146 -----g~-~y~aPE~~~~~~~~~~~~DiwSlG~~l~~l~tg~~Pf~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~  215 (218)
                           |+ .|+|||. +.+..|+.++|||||||++|+|+||+.||.+.+...+...+.....++.+..    +-+++..|
T Consensus       182 ~~~~~GT~~YmAPE~-l~~~~y~~~~DiwSlGvilyemltG~~PF~~~~~~~~~~~i~~~~~~~~~~~~s~~~~~li~~~  260 (350)
T 4b9d_A          182 ARACIGTPYYLSPEI-CENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQL  260 (350)
T ss_dssp             HHHHHSCCTTCCHHH-HTTCCCCHHHHHHHHHHHHHHHHHSSCSCCCSSHHHHHHHHHHTCCCCCCTTSCHHHHHHHHHH
T ss_pred             ccccCCCccccCHHH-HCCCCCCcHHHHHHHHHHHHHHHHCCCCCCCcCHHHHHHHHHcCCCCCCCccCCHHHHHHHHHH
Confidence                 32 3999995 5566799999999999999999999999998765555554444333333322    33455555


Q ss_pred             c
Q 041487          216 L  216 (218)
Q Consensus       216 l  216 (218)
                      |
T Consensus       261 L  261 (350)
T 4b9d_A          261 F  261 (350)
T ss_dssp             T
T ss_pred             c
Confidence            5



>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 218
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 1e-29
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-27
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 2e-27
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-25
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-24
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 6e-24
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 4e-22
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 4e-22
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 5e-22
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 9e-22
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-05
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-21
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-06
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 2e-21
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-21
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 5e-21
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 4e-07
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 6e-21
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-20
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-20
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 4e-05
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 2e-20
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-20
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 7e-06
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 3e-20
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 4e-20
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 4e-04
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 5e-20
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 1e-19
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-19
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 6e-19
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 6e-19
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 7e-19
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 7e-19
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-05
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 7e-18
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 3e-17
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 1e-06
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 6e-17
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 0.001
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 6e-17
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 8e-17
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 1e-16
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-16
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-16
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-05
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-16
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 3e-16
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 3e-16
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 4e-16
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 5e-16
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 7e-16
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 7e-16
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 6e-07
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 2e-15
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 1e-04
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-15
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 3e-15
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-15
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 4e-15
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 1e-14
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 1e-14
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 1e-14
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 3e-14
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 4e-04
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 7e-14
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 8e-14
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 8e-14
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 1e-13
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 6e-04
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 2e-13
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 0.003
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-13
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 1e-11
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 0.002
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-11
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-11
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 3e-11
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 6e-06
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Dual specificity mitogen-activated protein kinase kinase 1, Mek1
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  110 bits (275), Expect = 1e-29
 Identities = 42/216 (19%), Positives = 80/216 (37%), Gaps = 58/216 (26%)

Query: 38  VKDWNYKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQNEPEGVPSYLIAGVSLLKEL 97
           +KD +++ + ++G G  G V+K  +  +G  +A K+I+++ +P  + + +I  + +L E 
Sbjct: 3   LKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKP-AIRNQIIRELQVLHEC 61

Query: 98  EHDNIVRLLDVLTTGRYVYLVFEYLDL-DLGSFIRK-----------------------H 133
               IV       +   + +  E++D   L   ++K                        
Sbjct: 62  NSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLR 121

Query: 134 TITSI--------------RPHIK-----------------EVGSP-YKAPESRIRSSVY 161
               I              R  IK                  VG+  Y +PE R++ + Y
Sbjct: 122 EKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPE-RLQGTHY 180

Query: 162 STPHDVWAVGCIFAEMVSGKPLFPCGKKDHLSLIVR 197
           S   D+W++G    EM  G+   P      L L+  
Sbjct: 181 SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFG 216


>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.98
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.98
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.98
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.98
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.98
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.98
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.98
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.97
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.97
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.97
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.97
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.97
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.97
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.97
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.97
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.97
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.97
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.97
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.97
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.97
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.97
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.97
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.96
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.96
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.96
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.96
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.96
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.96
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.96
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.96
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.96
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.96
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.96
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.96
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.95
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.95
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.95
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.95
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.95
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.95
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.95
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.94
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.94
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.94
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.93
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.87
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.03
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 95.43
d2pula1 392 Methylthioribose kinase MtnK {Bacillus subtilis [T 93.19
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 92.8
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Aurora-related kinase 1 (aurora-2)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.6e-34  Score=227.54  Aligned_cols=159  Identities=26%  Similarity=0.425  Sum_probs=130.9

Q ss_pred             hccceeEEEEeeecCceEEEEEEEccCCcEEEEEEeecCC-CCCCchHHHHHHHHHHhhCCCCCeeeeeeeEEeCCEEEE
Q 041487           39 KDWNYKVVEKIGQGVFGEVYKCLNLETGKKVAIKMINIQN-EPEGVPSYLIAGVSLLKELEHDNIVRLLDVLTTGRYVYL  117 (218)
Q Consensus        39 ~~~~~~~~~~ig~G~~g~v~~~~~~~~~~~vaiK~~~~~~-~~~~~~~~~~~e~~~l~~l~h~~iv~~~~~~~~~~~~~l  117 (218)
                      ..++|++.+.||+|+||.||+|+++.+++.||+|++.+.. ......+.+.+|+.++++++||||+++++++.+.+.+|+
T Consensus         4 ~l~dy~i~~~iG~G~fg~Vy~~~~~~~~~~vAiK~i~~~~~~~~~~~~~~~~E~~il~~l~hpnIv~~~~~~~~~~~~~i   83 (263)
T d2j4za1           4 ALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYL   83 (263)
T ss_dssp             CGGGEEEEEEEEECSSEEEEEEEETTTCCEEEEEEEEHHHHHHTTCHHHHHHHHHHHHTCCCTTBCCEEEEEECSSEEEE
T ss_pred             chhHeEEEEEEecCCCcEEEEEEECCCCcEEEEEEEchHHccChHHHHHHHHHHHHHHhcCCCCCCeEEEEEEECCEEEE
Confidence            4578999999999999999999999999999999987543 234556789999999999999999999999999999999


Q ss_pred             EEecCCC-ChHHHhhhcccC---------------------------Cccccc-----------cccCC-----------
Q 041487          118 VFEYLDL-DLGSFIRKHTIT---------------------------SIRPHI-----------KEVGS-----------  147 (218)
Q Consensus       118 v~E~~~~-~L~~~~~~~~~~---------------------------~~~~~~-----------~~~g~-----------  147 (218)
                      |||||++ +|.+++......                           |++|.+           .+||.           
T Consensus        84 vmEy~~~g~L~~~l~~~~~l~e~~~~~i~~qi~~al~~lH~~~ivHrDiKp~Nill~~~~~~kl~DFG~a~~~~~~~~~~  163 (263)
T d2j4za1          84 ILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTT  163 (263)
T ss_dssp             EEECCTTCBHHHHHHHHSSCCHHHHHHHHHHHHHHHHHHHHTTCCCCCCCGGGEEECTTSCEEECCCCSCSCCCCCCCEE
T ss_pred             EEeecCCCcHHHHHhhcCCCCHHHHHHHHHHHHHHHHHHHHCCeeeeeeccccceecCCCCEeecccceeeecCCCcccc
Confidence            9999987 999988765432                           444433           23332           


Q ss_pred             -----cccCcccccCCCCCCCcchHHHHHHHHHHHHhCCCCCCCCCcchHHHHHHH
Q 041487          148 -----PYKAPESRIRSSVYSTPHDVWAVGCIFAEMVSGKPLFPCGKKDHLSLIVRY  198 (218)
Q Consensus       148 -----~y~aPE~~~~~~~~~~~~DiwSlG~~l~~l~tg~~Pf~~~~~~~~~~~~~~  198 (218)
                           .|+|||. ..+..++.++|||||||++|+|++|+.||.+.+...+...+..
T Consensus       164 ~~Gt~~Y~APE~-~~~~~~~~~~DiwSlGvilyell~G~~Pf~~~~~~~~~~~i~~  218 (263)
T d2j4za1         164 LCGTLDYLPPEM-IEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISR  218 (263)
T ss_dssp             TTEEGGGCCHHH-HTTCCCCTTHHHHHHHHHHHHHHHSSCTTCCSSHHHHHHHHHT
T ss_pred             cCCCCcccCHHH-HcCCCCCchhhhhhHhHHHHHHhcCCCCCCCCCHHHHHHHHHc
Confidence                 3999995 4556689999999999999999999999998766655554443



>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure