Citrus Sinensis ID: 041500

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MLQKFSCNDSSKLLHPCGSFHFCYIALPMHVNVKSIDKSKESLFLHQPRFQPENLEHNKKLFERVNEIAVKKGCTPSQLALAWVHHQGNDVCPIPGTTKIENLNQNIKALSVKLSPEEMAELESIASADAVRGHRYGGVTPTYEDSETPPVSSWKPS
cccccccccccccccccccccEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccEEEcccccccccHHHHHccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccc
cccEEccccccccccccccEEEEEEEcccEEcccccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccHHHHHHHHHHcHEEEEccHHHHHHHHHHccccHccccccHHHHHHHcccccccccHHccc
mlqkfscndsskllhpcgsfhfcyialpmhvnvksidkskeslflhqprfqpenlehNKKLFERVNEIavkkgctpsQLALAWVHHqgndvcpipgttkIENLNQNIKALSVKLSPEEMAELESIASAdavrghryggvtptyedsetppvsswkps
MLQKFSCNDSSKLLHPCGSFHFCYIALPMHVNVKSIDKSKESLFLHqprfqpenlehNKKLFERVNEIAVKKGCTPSQLALAWVHHQGNDVCPIPGTTKIENLNQNIKALSVKLSPEEMAELESIasadavrghRYGGvtptyedsetppvsswkps
MLQKFSCNDSSKLLHPCGSFHFCYIALPMHVNVKSIDKSKESLFLHQPRFQPENLEHNKKLFERVNEIAVKKGCTPSQLALAWVHHQGNDVCPIPGTTKIENLNQNIKALSVKLSPEEMAELESIASADAVRGHRYGGVTPTYEDSETPPVSSWKPS
***********KLLHPCGSFHFCYIALPMHVNVKSIDKS*ESLFLH**********HNKKLFERVNEIAVKKGCTPSQLALAWVHHQGNDVCPIPGTTKIENLNQNIKALS**********************************************
MLQKFSCNDSSKLLHPCGSFHFCYIALPMHVNVKSIDKSKESLFLHQPRFQPENLEHNKKLFERVNEIAVKKGCTPSQLALAWVHHQGNDVCPIPGTTKIENLNQNIKALSVKLSPEEMAELESIASADAVRGHRYGGVTPTYEDSETPPVS*W***
*********SSKLLHPCGSFHFCYIALPMHVNVKSIDKSKESLFLHQPRFQPENLEHNKKLFERVNEIAVKKGCTPSQLALAWVHHQGNDVCPIPGTTKIENLNQNIKALSVKLSPEEMAELESIASADAVRGHRYGGVTPT***************
*LQKFSCNDSSKLLHPCGSFHFCYIALPMHVNVKSIDKSKESLFLHQPRFQPENLEHNKKLFERVNEIAVKKGCTPSQLALAWVHHQGNDVCPIPGTTKIENLNQNIKALSVKLSPEEMAELESIASADAVRGHRYGGVTPTYEDSETPPVS*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQKFSCNDSSKLLHPCGSFHFCYIALPMHVNVKSIDKSKESLFLHQPRFQPENLEHNKKLFERVNEIAVKKGCTPSQLALAWVHHQGNDVCPIPGTTKIENLNQNIKALSVKLSPEEMAELESIASADAVRGHRYGGVTPTYEDSETPPVSSWKPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query157 2.2.26 [Sep-21-2011]
A2XRZ0351 Probable aldo-keto reduct N/A no 0.745 0.333 0.714 3e-44
Q7XT99351 Probable aldo-keto reduct yes no 0.745 0.333 0.714 4e-44
O22707345 Probable aldo-keto reduct yes no 0.681 0.310 0.710 4e-43
F4HPY8330 Probable aldo-keto reduct no no 0.713 0.339 0.714 5e-43
Q84M96346 Probable aldo-keto reduct no no 0.700 0.317 0.681 8e-42
Q9ASZ9345 Probable aldo-keto reduct no no 0.700 0.318 0.7 2e-41
Q93ZN2345 Probable aldo-keto reduct no no 0.700 0.318 0.681 4e-41
Q7XQ45355 Probable aldo-keto reduct no no 0.687 0.304 0.697 7e-41
A2XRZ6355 Probable aldo-keto reduct N/A no 0.687 0.304 0.697 7e-41
Q9C5B9344 Probable aldo-keto reduct no no 0.681 0.311 0.700 4e-40
>sp|A2XRZ0|AKR2_ORYSI Probable aldo-keto reductase 2 OS=Oryza sativa subsp. indica GN=OsI_15387 PE=3 SV=1 Back     alignment and function desciption
 Score =  177 bits (448), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 96/119 (80%), Gaps = 2/119 (1%)

Query: 39  SKESLFLHQPRFQPENLEHNKKLFERVNEIAVKKGCTPSQLALAWVHHQGNDVCPIPGTT 98
           S +    H PRFQ ENLE N ++FERVN +A +KGCTPSQLALAWVHHQG+DVCPIPGTT
Sbjct: 231 SDQDFRKHIPRFQQENLEKNAEIFERVNAMAARKGCTPSQLALAWVHHQGSDVCPIPGTT 290

Query: 99  KIENLNQNIKALSVKLSPEEMAELESIASADAVRGHRY--GGVTPTYEDSETPPVSSWK 155
           KIENLNQNI ALSVKL+PEEMAELES AS D VRG RY       T+++SETPP+SSWK
Sbjct: 291 KIENLNQNIGALSVKLTPEEMAELESYASTDDVRGDRYPQAMANTTWQNSETPPLSSWK 349

Oryza sativa subsp. indica (taxid: 39946)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q7XT99|AKR2_ORYSJ Probable aldo-keto reductase 2 OS=Oryza sativa subsp. japonica GN=Os04g0338000 PE=2 SV=2 Back     alignment and function description
>sp|O22707|ALKR3_ARATH Probable aldo-keto reductase 3 OS=Arabidopsis thaliana GN=At1g60690 PE=3 SV=1 Back     alignment and function description
>sp|F4HPY8|AKR6_ARATH Probable aldo-keto reductase 6 OS=Arabidopsis thaliana GN=At1g60750 PE=3 SV=1 Back     alignment and function description
>sp|Q84M96|ALKR2_ARATH Probable aldo-keto reductase 2 OS=Arabidopsis thaliana GN=AGD2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ASZ9|ALKR5_ARATH Probable aldo-keto reductase 5 OS=Arabidopsis thaliana GN=At1g60730 PE=2 SV=1 Back     alignment and function description
>sp|Q93ZN2|ALKR4_ARATH Probable aldo-keto reductase 4 OS=Arabidopsis thaliana GN=At1g60710 PE=1 SV=1 Back     alignment and function description
>sp|Q7XQ45|AKR3_ORYSJ Probable aldo-keto reductase 3 OS=Oryza sativa subsp. japonica GN=Os04g0339400 PE=2 SV=2 Back     alignment and function description
>sp|A2XRZ6|AKR3_ORYSI Probable aldo-keto reductase 3 OS=Oryza sativa subsp. indica GN=H0813E03.4 PE=3 SV=1 Back     alignment and function description
>sp|Q9C5B9|AKR1_ARATH Probable aldo-keto reductase 1 OS=Arabidopsis thaliana GN=At1g10810 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
118487572 345 unknown [Populus trichocarpa] 0.713 0.324 0.785 3e-47
224131488 343 predicted protein [Populus trichocarpa] 0.700 0.320 0.8 3e-47
62526573 344 aldo/keto reductase AKR [Manihot esculen 0.700 0.319 0.809 5e-47
359477983 330 PREDICTED: auxin-induced protein PCNT115 0.707 0.336 0.783 2e-46
225433670 341 PREDICTED: auxin-induced protein PCNT115 0.687 0.316 0.805 2e-46
296089612 318 unnamed protein product [Vitis vinifera] 0.687 0.339 0.805 3e-46
255555136 342 aldo/keto reductase, putative [Ricinus c 0.700 0.321 0.781 4e-46
255601816112 aldo/keto reductase, putative [Ricinus c 0.713 1.0 0.794 5e-46
147790725 335 hypothetical protein VITISV_015428 [Viti 0.687 0.322 0.796 2e-45
356526629 325 PREDICTED: auxin-induced protein PCNT115 0.726 0.350 0.754 3e-45
>gi|118487572|gb|ABK95612.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 88/112 (78%), Positives = 100/112 (89%)

Query: 46  HQPRFQPENLEHNKKLFERVNEIAVKKGCTPSQLALAWVHHQGNDVCPIPGTTKIENLNQ 105
           H PRFQPENL+HN++LFERVNEIA +K CTPSQLALAWVHHQG+DVCPIPGTTKIEN NQ
Sbjct: 234 HLPRFQPENLDHNRQLFERVNEIAARKQCTPSQLALAWVHHQGDDVCPIPGTTKIENFNQ 293

Query: 106 NIKALSVKLSPEEMAELESIASADAVRGHRYGGVTPTYEDSETPPVSSWKPS 157
           N+ ALSVKL+PEEMAELESIASA AV+G RY G   TY+DS+TPP+SSWK +
Sbjct: 294 NVGALSVKLTPEEMAELESIASAGAVKGDRYEGSMFTYKDSDTPPLSSWKAT 345

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224131488|ref|XP_002321097.1| predicted protein [Populus trichocarpa] gi|222861870|gb|EEE99412.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|62526573|gb|AAX84672.1| aldo/keto reductase AKR [Manihot esculenta] Back     alignment and taxonomy information
>gi|359477983|ref|XP_003632047.1| PREDICTED: auxin-induced protein PCNT115 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225433670|ref|XP_002265927.1| PREDICTED: auxin-induced protein PCNT115 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089612|emb|CBI39431.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255555136|ref|XP_002518605.1| aldo/keto reductase, putative [Ricinus communis] gi|223542204|gb|EEF43747.1| aldo/keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255601816|ref|XP_002537758.1| aldo/keto reductase, putative [Ricinus communis] gi|223515200|gb|EEF24625.1| aldo/keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147790725|emb|CAN67592.1| hypothetical protein VITISV_015428 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356526629|ref|XP_003531919.1| PREDICTED: auxin-induced protein PCNT115-like isoform 2 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
TAIR|locus:2036611345 AT1G60690 "AT1G60690" [Arabido 0.681 0.310 0.710 1.2e-40
TAIR|locus:2036551330 AT1G60750 [Arabidopsis thalian 0.713 0.339 0.714 4.2e-40
TAIR|locus:2036591346 AT1G60680 "AT1G60680" [Arabido 0.687 0.312 0.694 1.8e-39
TAIR|locus:2036504345 ATB2 [Arabidopsis thaliana (ta 0.687 0.313 0.694 9.9e-39
TAIR|locus:2196446344 AT1G10810 "AT1G10810" [Arabido 0.681 0.311 0.700 1.1e-37
ASPGD|ASPL0000051701339 AN10217 [Emericella nidulans ( 0.566 0.262 0.449 1.1e-16
TIGR_CMR|GSU_3126334 GSU_3126 "oxidoreductase, aldo 0.566 0.266 0.438 1.8e-16
UNIPROTKB|G4NAH9341 MGG_09715 "Aldo-keto reductase 0.643 0.296 0.403 1.7e-15
POMBASE|SPAC1F7.12340 yak3 "aldose reductase ARK13 f 0.738 0.341 0.388 2.1e-15
ASPGD|ASPL0000035025328 AN9179 [Emericella nidulans (t 0.694 0.332 0.358 3.2e-14
TAIR|locus:2036611 AT1G60690 "AT1G60690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 432 (157.1 bits), Expect = 1.2e-40, P = 1.2e-40
 Identities = 76/107 (71%), Positives = 96/107 (89%)

Query:    48 PRFQPENLEHNKKLFERVNEIAVKKGCTPSQLALAWVHHQGNDVCPIPGTTKIENLNQNI 107
             PRFQ ENL+HNK L+E+V+ ++ KKGCTP+QLALAWVHHQG+DVCPIPGTTKIENLNQNI
Sbjct:   236 PRFQQENLDHNKILYEKVSAMSEKKGCTPAQLALAWVHHQGDDVCPIPGTTKIENLNQNI 295

Query:   108 KALSVKLSPEEMAELESIASADAVRGHRYGGVTPTYEDSETPPVSSW 154
             +ALSVKL+PEEM+ELE+IA  ++V+G RY    PT+++S+TPP+SSW
Sbjct:   296 RALSVKLTPEEMSELETIAQPESVKGERYMATVPTFKNSDTPPLSSW 342
GO:0004033 "aldo-keto reductase (NADP) activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2036551 AT1G60750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036591 AT1G60680 "AT1G60680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036504 ATB2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196446 AT1G10810 "AT1G10810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000051701 AN10217 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3126 GSU_3126 "oxidoreductase, aldo/keto reductase family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|G4NAH9 MGG_09715 "Aldo-keto reductase yakc" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
POMBASE|SPAC1F7.12 yak3 "aldose reductase ARK13 family YakC" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000035025 AN9179 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O22707ALKR3_ARATH1, ., 1, ., 1, ., -0.71020.68150.3101yesno
Q7XT99AKR2_ORYSJ1, ., 1, ., 1, ., -0.71420.74520.3333yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
COG0667316 COG0667, Tas, Predicted oxidoreductases (related t 3e-27
cd06660285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 3e-22
pfam00248277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 2e-16
COG0656280 COG0656, ARA1, Aldo/keto reductases, related to di 9e-15
PRK11172267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 2e-13
PRK10376290 PRK10376, PRK10376, putative oxidoreductase; Provi 7e-13
TIGR01293317 TIGR01293, Kv_beta, voltage-dependent potassium ch 2e-07
PRK10625346 PRK10625, tas, putative aldo-keto reductase; Provi 3e-07
COG4989298 COG4989, COG4989, Predicted oxidoreductase [Genera 1e-06
PRK09912346 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r 0.001
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information 
 Score =  103 bits (258), Expect = 3e-27
 Identities = 37/93 (39%), Positives = 52/93 (55%)

Query: 41  ESLFLHQPRFQPENLEHNKKLFERVNEIAVKKGCTPSQLALAWVHHQGNDVCPIPGTTKI 100
            S     PRFQ E  E    +   + E+A + G TP+Q+ALAWV  Q     PI G +K 
Sbjct: 223 GSRASELPRFQRELTERGLAILRALEELAKELGATPAQVALAWVLAQPGVTSPIVGASKA 282

Query: 101 ENLNQNIKALSVKLSPEEMAELESIASADAVRG 133
           E L +N+ AL +KLS EE+A L+ I++ +   G
Sbjct: 283 EQLEENLAALDIKLSEEELAALDEISAEEPTPG 315

Length = 316
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional Back     alignment and domain information
>gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 157
KOG1575336 consensus Voltage-gated shaker-like K+ channel, su 99.9
COG0667316 Tas Predicted oxidoreductases (related to aryl-alc 99.89
PRK10625346 tas putative aldo-keto reductase; Provisional 99.84
TIGR01293317 Kv_beta voltage-dependent potassium channel beta s 99.82
PRK09912346 L-glyceraldehyde 3-phosphate reductase; Provisiona 99.81
PF00248283 Aldo_ket_red: Aldo/keto reductase family; InterPro 99.78
COG0656280 ARA1 Aldo/keto reductases, related to diketogulona 99.75
PRK11172267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 99.72
PLN02587314 L-galactose dehydrogenase 99.72
KOG1577300 consensus Aldo/keto reductase family proteins [Gen 99.7
PRK11565275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 99.7
PRK10376290 putative oxidoreductase; Provisional 99.68
cd06660285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 99.67
PRK14863292 bifunctional regulator KidO; Provisional 99.65
COG4989298 Predicted oxidoreductase [General function predict 99.57
COG1453391 Predicted oxidoreductases of the aldo/keto reducta 99.31
KOG1576342 consensus Predicted oxidoreductase [Energy product 99.3
>KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] Back     alignment and domain information 
Probab=99.90  E-value=1.5e-23  Score=166.41  Aligned_cols=136  Identities=35%  Similarity=0.477  Sum_probs=112.8

Q ss_pred             Ccccccc-ccccccccchhcCCeEec-ccccCCccCCCCCCCCccC------CCCCCCccc-h-HhhHHHHHHHHHHHHH
Q 041500            2 LQKFSCN-DSSKLLHPCGSFHFCYIA-LPMHVNVKSIDKSKESLFL------HQPRFQPEN-L-EHNKKLFERVNEIAVK   71 (157)
Q Consensus         2 ~~~~~~~-~~~~ll~~~~~~gi~v~~-~pl~~G~~~~~~~~~~~~r------~~~~~~~~~-~-~~~~~~~~~l~~ia~~   71 (157)
                      |+.|++. ++.+++++|+++||++++ |||+.|.+++..-...+.+      ....+.+.. - ...+.+++++.++|++
T Consensus       190 ysl~~Rd~ee~~i~~~c~~~Gi~li~ysPL~~G~Ltgk~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iA~k  269 (336)
T KOG1575|consen  190 YSLLSRDKEERGIIPLCRELGIGLIAWSPLGRGLLTGKYKLGEDSRNGDKRFQFLGLSPQTEEGDKQKPILEALSKIAEK  269 (336)
T ss_pred             chhhhcchhhhhHHHHHHHcCcceEEecccccceeccCcccccccccccccccccccccccchhhhHHHHHHHHHHHHHH
Confidence            5677887 777899999999999999 9999998766544333333      112221110 1 6688899999999999


Q ss_pred             hCCCHHHHHHHHHHhCCCCeEeecCCCCHHHHHHHHhccCCCCCHHHHHHHHhhhccCCcCCCCCC
Q 041500           72 KGCTPSQLALAWVHHQGNDVCPIPGTTKIENLNQNIKALSVKLSPEEMAELESIASADAVRGHRYG  137 (157)
Q Consensus        72 ~g~s~aqlaL~w~l~~~~v~~~I~G~~~~~ql~en~~a~~~~Ls~e~~~~l~~~~~~~~~~~~~~~  137 (157)
                      +|+|++|+||+|+++++.|.+||||+++.+|++||++|+.+.|+++++.+|+++.++....+.+|+
T Consensus       270 ~g~T~~qlALawv~~~~~v~~pIpG~s~ve~l~eni~Al~~~Lt~e~~~~l~~~~~~~~~~~~~~~  335 (336)
T KOG1575|consen  270 HGCTVPQLALAWVLSNGKVSSPIPGASKIEQLKENIGALSVKLTPEEIKELEEIIDKILGFGPRSI  335 (336)
T ss_pred             cCCCHHHHHHHHHHHhCCCEEecCCCCcHHHHHHHHhhhhccCCHHHHHHHHHhhccccCcCCCCC
Confidence            999999999999999999999999999999999999999999999999999999988766666654

>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
3v0u_A338 Crystal Structure Of Perakine Reductase, Founder Me 4e-24
3uyi_A337 Crystal Structure Of Perakine Reductase, Founder Me 4e-24
3v0t_A337 Crystal Structure Of Perakine Reductase, Founder Me 5e-24
3v0s_A337 Crystal Structure Of Perakine Reductase, Founder Me 2e-23
1lqa_A346 Tas Protein From Escherichia Coli In Complex With N 9e-07
1vp5_A298 Crystal Structure Of 2,5-diketo-d-gluconic Acid Red 4e-05
3erp_A353 Structure Of Idp01002, A Putative Oxidoreductase Fr 2e-04
1zgd_A312 Chalcone Reductase Complexed With Nadp+ At 1.7 Angs 5e-04
3n6q_A346 Crystal Structure Of Yghz From E. Coli Length = 346 6e-04
4aub_A366 The Complex Structure Of The Bacterial Aldo-Keto Re 6e-04
>pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 Back     alignment and structure 
Iteration: 1

 Score =  106 bits (265), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 79/123 (64%), Gaps = 6/123 (4%)
Query: 34  KSIDKS--KESLFLHQPRFQPENLEHNKKLFERVNEIAVKKGCTPSQLALAWVHHQGNDV 91
           K+I +S  + S+    PRF  ENLE NK+++ R+  ++ K GCTP QLALAWV HQG DV
Sbjct: 216 KAIKESLPENSVLTSHPRFVGENLEKNKQIYYRIEALSQKHGCTPVQLALAWVLHQGEDV 275
Query: 92  CPIPGTTKIENLNQNIKALSVKLSPEEMAELESIASADAVRG---HRYGGVTPTYEDSET 148
            PIPGTTKI+NL+ N+ AL VKL+ E++ E+      D V G   H    VT  ++ + T
Sbjct: 276 VPIPGTTKIKNLHNNVGALKVKLTKEDLKEISDAVPLDEVAGESIHEVIAVT-NWKFANT 334
Query: 149 PPV 151
           PP+
Sbjct: 335 PPL 337
>pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 Back     alignment and structure
>pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 Back     alignment and structure
>pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 Back     alignment and structure
>pdb|1ZGD|A Chain A, Chalcone Reductase Complexed With Nadp+ At 1.7 Angstrom Resolution Length = 312 Back     alignment and structure
>pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 Back     alignment and structure
>pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 1e-52
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 8e-43
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 1e-40
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 1e-35
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 2e-26
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 6e-24
3erp_A353 Putative oxidoreductase; funded by the national in 3e-20
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 5e-19
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 8e-19
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 1e-18
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 1e-16
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 3e-15
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 7e-15
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 2e-12
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 2e-12
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 5e-12
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 6e-12
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 9e-12
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 2e-11
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 3e-11
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 5e-11
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 6e-11
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 1e-10
2ao0_A324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 2e-10
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 2e-10
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 2e-10
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 2e-10
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 4e-09
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 9e-09
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 9e-09
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 1e-08
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 1e-08
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 1e-08
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 2e-08
4gie_A290 Prostaglandin F synthase; structural genomics, nia 2e-08
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 2e-08
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 3e-08
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 6e-08
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure
 Score =  169 bits (429), Expect = 1e-52
 Identities = 51/120 (42%), Positives = 69/120 (57%), Gaps = 2/120 (1%)

Query: 33  VKSIDKSKESLFLHQPRFQPENLEHNKKLFERVNEIAVKKGCTPSQLALAWVHHQGNDVC 92
                  + S+    PRF  ENLE NK+++ R+  ++ K GCTP QLALAWV HQG DV 
Sbjct: 216 AIKESLPENSVLTSHPRFVGENLEKNKQIYYRIEALSQKHGCTPVQLALAWVLHQGEDVV 275

Query: 93  PIPGTTKIENLNQNIKALSVKLSPEEMAELESIASADAVRGHRY--GGVTPTYEDSETPP 150
           PIPGTTKI+NL+ N+ AL V L+ E++ E+      D V G           ++ + TPP
Sbjct: 276 PIPGTTKIKNLHNNVGALKVXLTKEDLKEISDAVPLDEVAGESIHEVIAVTNWKFANTPP 335
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 99.94
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 99.9
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 99.89
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 99.89
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 99.87
3erp_A353 Putative oxidoreductase; funded by the national in 99.86
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 99.85
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 99.85
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 99.85
4gac_A324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 99.84
3b3d_A314 YTBE protein, putative morphine dehydrogenase; ald 99.84
4gie_A290 Prostaglandin F synthase; structural genomics, nia 99.84
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 99.83
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 99.81
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 99.81
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 99.81
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 99.8
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 99.79
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 99.79
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 99.79
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 99.79
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 99.78
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 99.78
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 99.78
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 99.78
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 99.78
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 99.78
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 99.78
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 99.76
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 99.76
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 99.76
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 99.76
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 99.76
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 99.76
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 99.75
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 99.75
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 99.73
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 99.73
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 99.73
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 99.6
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
Probab=99.94  E-value=5.3e-27  Score=187.24  Aligned_cols=150  Identities=36%  Similarity=0.621  Sum_probs=102.6

Q ss_pred             CccccccccccccccchhcCCeEec-ccccCCccCC----CCCCCCccC-CCCCCCccchHhhHHHHHHHHHHHHHhCCC
Q 041500            2 LQKFSCNDSSKLLHPCGSFHFCYIA-LPMHVNVKSI----DKSKESLFL-HQPRFQPENLEHNKKLFERVNEIAVKKGCT   75 (157)
Q Consensus         2 ~~~~~~~~~~~ll~~~~~~gi~v~~-~pl~~G~~~~----~~~~~~~~r-~~~~~~~~~~~~~~~~~~~l~~ia~~~g~s   75 (157)
                      ||.+.++...+++++|+++||++++ +||++|.+++    ..++++++| ..+.|.++..++.++.++.|.+||+++|+|
T Consensus       179 ~~~~~~~~e~~l~~~~~~~gi~v~a~spL~~G~L~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ia~~~g~t  258 (337)
T 3v0s_A          179 YSLWTRDIEDEIVPLCRQLGIGIVPYSPIGRGLFWGKAIKESLPENSVLTSHPRFVGENLEKNKQIYYRIEALSQKHGCT  258 (337)
T ss_dssp             CBTTBCGGGTTHHHHHHHHTCEEEEESTTHHHHHHHHHHHC-------------------------CHHHHHHHHHTTSC
T ss_pred             ccccccchhHHHHHHHHHcCceEEEeccccCcccCCCCCCCCCCCcchhhcccccchhhhhhHHHHHHHHHHHHHHhCCC
Confidence            5666666667999999999999999 9999996432    345555666 566777666778888889999999999999


Q ss_pred             HHHHHHHHHHhCCCCeEeecCCCCHHHHHHHHhccCCCCCHHHHHHHHhhhccCCcCCCCCCC--CCCCccCCCCCCC
Q 041500           76 PSQLALAWVHHQGNDVCPIPGTTKIENLNQNIKALSVKLSPEEMAELESIASADAVRGHRYGG--VTPTYEDSETPPV  151 (157)
Q Consensus        76 ~aqlaL~w~l~~~~v~~~I~G~~~~~ql~en~~a~~~~Ls~e~~~~l~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~  151 (157)
                      ++|+||+|++++|.|++||||+++++||++|+++++++|++++++.|+++.....+.+.||+.  ....|+++.|+|+
T Consensus       259 ~aqvaL~w~l~~~~v~~~I~g~~~~~~l~en~~a~~~~L~~e~~~~l~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~  336 (337)
T 3v0s_A          259 PVQLALAWVLHQGEDVVPIPGTTKIKNLHNNVGALKVXLTKEDLKEISDAVPLDEVAGESIHEVIAVTNWKFANTPPL  336 (337)
T ss_dssp             HHHHHHHHHHTTCTTBCCCCCCSCHHHHHHHHHGGGCCCCHHHHHHHHHTCC-----------------CTTCCCCCC
T ss_pred             HHHHHHHHHHhCCCCeEEEcCCCCHHHHHHHHHHhccCCCHHHHHHHHHhhcccCCCCCCchHHHhhhhhhcCCCCCC
Confidence            999999999999999999999999999999999999999999999999999888888999999  6678999999886
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 157
d1lqaa_346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 1e-23
d1pyfa_311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 6e-22
d3eaua1326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 2e-21
d1us0a_314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 1e-20
d1hqta_324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 6e-20
d1mi3a_319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 2e-19
d1frba_315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 3e-19
d1ur3m_298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 3e-19
d1s1pa_315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 8e-18
d1vp5a_284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 8e-18
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 2e-17
d1mzra_274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 2e-17
d1afsa_319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 2e-17
d1pz1a_333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 7e-17
d1gvea_324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 2e-16
d1qwka_312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 2e-16
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Tas protein
species: Escherichia coli [TaxId: 562]

 Score = 92.3 bits (228), Expect = 1e-23
 Identities = 25/78 (32%), Positives = 44/78 (56%)

Query: 48  PRFQPENLEHNKKLFERVNEIAVKKGCTPSQLALAWVHHQGNDVCPIPGTTKIENLNQNI 107
            RF   + E  +K      +IA + G  P+Q+ALA+V  Q      + G T ++ L  NI
Sbjct: 260 SRFTRYSGEQTQKAVAAYVDIARRHGLDPAQMALAFVRRQPFVASTLLGATTMDQLKTNI 319

Query: 108 KALSVKLSPEEMAELESI 125
           ++L ++LS + +AE+E++
Sbjct: 320 ESLHLELSEDVLAEIEAV 337
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 324 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
d1pyfa_311 Putative oxidoreductase IolS {Bacillus subtilis [T 99.86
d1lqaa_346 Tas protein {Escherichia coli [TaxId: 562]} 99.86
d1pz1a_333 Putative oxidoreductase YhdN {Bacillus subtilis [T 99.86
d1qwka_312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 99.82
d1afsa_319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 99.82
d1hqta_324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 99.81
d1frba_315 FR-1 (fibroblast growth factor-induced) protein {M 99.81
d3eaua1326 Voltage-dependent K+ channel beta subunit {Rat (Ra 99.8
d1s1pa_315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 99.79
d1gvea_324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 99.79
d1mzra_274 2,5-diketo-D-gluconic acid reductase A {Escherichi 99.79
d1us0a_314 Aldose reductase (aldehyde reductase) {Human (Homo 99.78
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 99.77
d1mi3a_319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 99.75
d1vp5a_284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 99.63
d1ur3m_298 Hypothetical oxidoreductase YdhF {Escherichia coli 99.6
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Putative oxidoreductase IolS
species: Bacillus subtilis [TaxId: 1423]

Probab=99.86  E-value=4e-22  Score=154.66  Aligned_cols=127  Identities=19%  Similarity=0.307  Sum_probs=108.5

Q ss_pred             CccccccccccccccchhcCCeEec-ccccCCccCCC-----CCCCCccC-CCCCCCccchHhhHHHHHHHHHHHHHhCC
Q 041500            2 LQKFSCNDSSKLLHPCGSFHFCYIA-LPMHVNVKSID-----KSKESLFL-HQPRFQPENLEHNKKLFERVNEIAVKKGC   74 (157)
Q Consensus         2 ~~~~~~~~~~~ll~~~~~~gi~v~~-~pl~~G~~~~~-----~~~~~~~r-~~~~~~~~~~~~~~~~~~~l~~ia~~~g~   74 (157)
                      ||.+.+....+++++|+++||++++ +|+++|.++..     .++..+.+ ..+.+..+........++.+.++|+++|+
T Consensus       177 ~n~~~~~~~~~~~~~~~~~~i~v~~~~~l~~G~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ia~~~~~  256 (311)
T d1pyfa_         177 YNLLNREAEKTFFPYTKEHNISFIPYFPLVSGLLAGKYTEDTTFPEGDLRNEQEHFKGERFKENIRKVNKLAPIAEKHNV  256 (311)
T ss_dssp             CBTTBCGGGTTHHHHHHHHTCEEEEESTTTTTGGGTCCCTTCCCCTTCGGGGSGGGSHHHHHHHHHHHHTTHHHHHHTTS
T ss_pred             ecccchhhhHHHHHHHHHCCceEEEeccccCCccCCCcCcCCCCccccccccchhhccchhhHHHHHHHHHHHHHHHhCC
Confidence            5666677788999999999999999 99999986543     33333344 44445555667788889999999999999


Q ss_pred             CHHHHHHHHHHhCCCCeEeecCCCCHHHHHHHHhccCCCCCHHHHHHHHhhhcc
Q 041500           75 TPSQLALAWVHHQGNDVCPIPGTTKIENLNQNIKALSVKLSPEEMAELESIASA  128 (157)
Q Consensus        75 s~aqlaL~w~l~~~~v~~~I~G~~~~~ql~en~~a~~~~Ls~e~~~~l~~~~~~  128 (157)
                      |++|+||+|++++|.|++||+|+++++||++|+++++++|+++++++|+++..+
T Consensus       257 s~~q~al~~~l~~~~v~~vi~G~~~~~~l~en~~a~~~~L~~ee~~~l~~i~~~  310 (311)
T d1pyfa_         257 DIPHIVLAWYLARPEIDILIPGAKRADQLIDNIKTADVTLSQEDISFIDKLFAP  310 (311)
T ss_dssp             CHHHHHHHHHHHSTTCCCBCCCCSSHHHHHHHHGGGGCCCCHHHHHHHHHHTCC
T ss_pred             CHHHHHHHHHHhCCCCeEEEECCCCHHHHHHHHHhCCCCCCHHHHHHHhhhcCC
Confidence            999999999999999999999999999999999999999999999999999753
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure