Citrus Sinensis ID: 041608

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
IINSRFTSLSGNFQLVDGKLTSSGAFEIVNVIGKTLKRVGFWSPITRISKEMNSLVLFNKMNISSPSPNDDELEAVIWPGGSAAIPEGGGKINKLRIGVPVNGFKELVNAARDPQGTLIVEGICIDVFKSAIDSLTFEVPYEFIPFEDASGRMAGSSLYVDFTLPYTEMGIGMIVPIDQSNNIWIFLKPLEPNLWLTTAALFLLTSFVMWIIERPVNDEFQGSRAHQFGMIFWYSFSTLVFSQREKLFSNLSKFVVIVWLFVLASMDNIGSQLGSVVPGALSNLNFKDSRLKKYNSTKEYANALSKESKNGGISAIIDEMPYIKAFLAKYSAHYTLTAPKNTNSTNGFGFVFQKGSSLVHDISKAIARLREEGTLTKIENEWFIDRQSSFMHKGSISDNPSSLSLTNFGGLFLITGISLTLALVIFLLPSIYKKNAFWKEDPHESNRE
cccccEEEEEEEEEEccccccccccEEEEEEccccEEEEEEECcccccccccccHHHcccccccccccccccCEEEEcccccccccccccccccEEEEECcccccccEEEECccccccCEEcHHHHHHHHHHHHccccccEEEEEcccccccccccEEEEEECcccEECcEEEEEEccccccEEEECccccHHHHHHHHHHHHHHEEEEEEEEcccccccccccccccHHHHHHHHHEEEEccccccccccccEEEEEEHHHHHcccccccccccEEccccEEcccccccccccccHHHHHHHcccccccccEEEEEEccHHHHHHHHHcccccEEEccccccccccEEEEccccccccHHHHHHHHcccccccHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc
IINSRFTSLSGNFQLVDGKLTSSGAFEIVNVIGKTLKRVGFWSPITRISKEMNSLVLF**********NDDELEAVIWPGGSAAIPEGGGKINKLRIGVPVNGFKELVNAARDPQGTLIVEGICIDVFKSAIDSLTFEVPYEFIPFEDASGRMAGSSLYVDFTLPYTEMGIGMIVPIDQSNNIWIFLKPLEPNLWLTTAALFLLTSFVMWIIERPVNDEFQGSRAHQFGMIFWYSFSTLVFSQREKLFSNLSKFVVIVWLFVLASMDNIGSQLGSVVPGALSNLNFKDSRLKKYNSTKE************GISAIIDEMPYIKAFLAKYSAHYTLTAPKNTNSTNGFGFVFQKGSSLVHDISKAIARLREEGTLTKIENEWFIDRQS**************LSLTNFGGLFLITGISLTLALVIFLLPSIYKKNA************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IINSRFTSLSGNFQLVDGKLTSSGAFEIVNVIGKTLKRVGFWSPITRISKEMNSLVLFNKMNISSPSPNDDELEAVIWPGGSAAIPEGGGKINKLRIGVPVNGFKELVNAARDPQGTLIVEGICIDVFKSAIDSLTFEVPYEFIPFEDASGRMAGSSLYVDFTLPYTEMGIGMIVPIDQSNNIWIFLKPLEPNLWLTTAALFLLTSFVMWIIERPVNDEFQGSRAHQFGMIFWYSFSTLVFSQREKLFSNLSKFVVIVWLFVLASMDNIGSQLGSVVPGALSNLNFKDSRLKKYNSTKEYANALSKESKNGGISAIIDEMPYIKAFLAKYSAHYTLTAPKNTNSTNGFGFVFQKGSSLVHDISKAIARLREEGTLTKIENEWFIDRQSSFMHKGSISDNPSSLSLTNFGGLFLITGISLTLALVIFLLPSIYKKNAFWKEDPHESNRE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TQL, chain A
Confidence level:very confident
Coverage over the Query: 93-183,216-222,267-383
View the alignment between query and template
View the model in PyMOL
Template: 3G3K, chain A
Confidence level:confident
Coverage over the Query: 92-182,216-225,267-391
View the alignment between query and template
View the model in PyMOL
Template: 3H6G, chain A
Confidence level:confident
Coverage over the Query: 1-52
View the alignment between query and template
View the model in PyMOL
Template: 2K1E, chain A
Confidence level:probable
Coverage over the Query: 201-263
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3kg2, chain Avery confident Alignment | Template Structure